KEGG   Egretta garzetta (little egret): 104132947Help
Entry
104132947         CDS       T05152                                 

Gene name
CPM
Definition
(RefSeq) carboxypeptidase M
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:egz01002]
    104132947 (CPM)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:egz00537]
    104132947 (CPM)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     104132947 (CPM)
Peptidases and inhibitors [BR:egz01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   104132947 (CPM)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:egz00537]
 Enzymes
  104132947 (CPM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA Dioxygenase_C Big_1
Motif
Other DBs
NCBI-GeneID: 104132947
NCBI-ProteinID: XP_009644598
Position
Unknown
AA seq 359 aa AA seqDB search
MHGDETVGREILLHLIDFLVTSYRRDPIITRLLSNTRIHIMPTMNPDGFEATKVPDCYYT
RGRYNKNGEDLNRNFPDAFENNSATIQPETQAVMNWIKNETFVLSANLHGGALVASYTFD
NGNPVTGSLNGYSRSPDDDVFIHLAKTYSFNHASMYKGTGCDNRQTFPEGITNGYSWYQL
EGGMQDYNYVWGQCFEITLELSCCKYPPADQLEKFWRDNKVALIEYIKQVKLGVKGQVTD
KNGNPIPNAIVEAKGRPHVCPYRTNEQGEYFLLLLPGTYVINATVPGYKSMLKTLEIPDN
TGNFSALKHDFSFSEVSIRSSAASCPKTPLYQQLERDSAAVKPTLQISVLMTVMLVIFH
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcatggggatgagactgttgggagagaaatcctgctccatttgatagacttccttgtg
accagctatagacgtgacccaattattacccggttactcagtaatacccggattcatatc
atgccaacgatgaatcctgatggatttgaagctacaaaagtgcctgactgttactacaca
cgaggaaggtacaataagaatggagaagatctgaacagaaattttcctgatgcctttgaa
aataacagcgctactattcagccagagactcaagcagtaatgaactggataaaaaatgaa
acatttgttctttcggcgaacttgcatgggggtgccctggttgccagttacacttttgac
aatggtaacccagttactggctctttgaacggctatagcaggtctccagatgatgatgtc
tttattcacctggcaaaaacctattccttcaaccatgccagcatgtacaaggggactggg
tgtgacaacagacaaaccttcccagaaggcattaccaatggctattcttggtaccagcta
gaaggtggaatgcaagattacaactatgtctggggacagtgttttgaaattacattggag
ctgtcctgctgtaaataccctccagcagaccagttggaaaagttctggagagacaacaaa
gttgctctgatcgaatacataaaacaagtaaagctaggcgtcaagggtcaagttacggat
aagaacgggaatcctattcccaatgccatcgtggaagccaaaggaaggcctcatgtctgc
ccctacaggacaaacgaacaaggagagtactttcttctccttttgcctgggacatatgtg
atcaacgctactgtaccgggatacaaatcgatgctgaagacgctggaaatacccgacaac
accggtaacttcagtgctctgaaacacgacttctctttctcagaagtctccatcagatca
agcgctgcttcctgtcccaaaacgcccctctaccagcagctcgagcgggattcagccgca
gtaaaaccaactctacagatctcggtgttgatgacggttatgcttgtcattttccattaa

DBGET integrated database retrieval system