KEGG   Egretta garzetta (little egret): 104135478Help
Entry
104135478         CDS       T05152                                 

Gene name
NMNAT3
Definition
(RefSeq) nicotinamide mononucleotide adenylyltransferase 3
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00760  Nicotinate and nicotinamide metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    104135478 (NMNAT3)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     104135478 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     104135478 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 104135478
NCBI-ProteinID: XP_009647432
Position
Unknown
AA seq 270 aa AA seqDB search
MKSRIPLILLACGSFNPITNMHMRLFELARDHLHQTGRYRVIEGIMSPVNDDYGKKGLVS
ARHRIAMAKLALETSDWIRVDPWESEQETWTETVKVLRHHYNESLRLLRSKKELMKNKRP
IERSTEDSLSYQHSVLPELKLLCGADFLQTFKTPNLWKEEHIKEIVEKFGLVCISRAGSN
PAQYINESDLLTKFQHNIFLVKEWIQNEISATQIRYALCRGLSVKYLVPDSVISYIAHHN
IYTEESERKNEGDLLQPLKLHNTTVNPLND
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaggatacctctcattcttctagcttgtggctcctttaaccccatcacaaac
atgcatatgcgtttatttgagctggctagagatcacctgcaccaaacaggaaggtatcgg
gtgatcgaaggcataatgtctcctgttaatgacgactacggaaagaaaggcttggtttca
gcaaggcacaggatagctatggctaaactagcactggaaacatctgactggattcgagtt
gatccatgggagagtgagcaggagacatggacagagacagtaaaagtattaaggcaccat
tacaatgaatcactcagattgctccggtccaagaaggaattaatgaaaaacaaacggccc
atagaaagatctacagaggattccctttcttaccagcactcagttctaccagaattaaag
ctgctctgtggggctgattttctacagacatttaagacacccaatctctggaaggaagaa
cacatcaaagaaatagtggaaaagtttggtttggtctgtattagccgtgctggctctaat
cctgctcagtatatcaatgaatcagaccttttaactaaatttcagcacaatatctttctg
gtgaaagaatggattcagaatgaaatcagtgcaacacagatacgctatgccttgtgcaga
ggattaagtgtaaaatatctcgtaccagattctgttatatcctacattgcacaccataat
atctacacagaagagagtgagcggaagaatgaaggtgacttgcttcagcctcttaagttg
cataacacaacagtaaacccactaaatgactga

DBGET integrated database retrieval system