KEGG   Ethanoligenens harbinense: Ethha_1323Help
Entry
Ethha_1323        CDS       T01384                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01130  Biosynthesis of antibiotics
eha01230  Biosynthesis of amino acids
Module
eha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ethha_1323
Enzymes [BR:eha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ethha_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NanE ThiG QRPTase_C FMN_dh NMO IMPDH Dus Glu_synthase
Motif
Other DBs
NCBI-ProteinID: ADU26863
UniProt: E6U696
Position
1441278..1442081
Genome map
AA seq 267 aa AA seqDB search
MSSETILDTIMANRRQQIAALKEKRPLHALAEQAFSAREKRTAVDFAATLKKPGLSVIAE
VKKASPSKGVIQPDFHPVEIARAYEAAGADAVSVLTEETYFQGGADTLTQVRGAVSLPVL
RKDFIFDEWQIAEACVLGADAILLIASVLDVFALKKLMAVAEMFGLQCLVEVRSESQVRD
ALRAGARVVGVNNRNLATFDVDLSTSARFRHLFPEDVVFVSESGIATAEDMKQAADLGAD
AVLIGETLMRAPDIHAKLKELRSLTHG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtgaaacgattttggataccatcatggccaaccgcaggcagcaaatcgccgcg
ctgaaagagaaacggccgctgcatgccctggctgagcaggcgttttccgcgcgtgaaaaa
cgcacggcggtggattttgccgcaacgctgaaaaagcccggcctgtcggtgatcgcggag
gtcaaaaaggcgtcgccgtcgaaaggggtcattcagccggacttccacccggtagaaatt
gcccgtgcatacgaggcggccggagcagatgcggtttccgtgctcaccgaggagacatat
ttccaaggcggcgcggataccttaacacaggtacgcggagccgtttcgctcccggtcctg
cggaaagatttcatttttgacgagtggcaaatcgccgaggcgtgcgtgctgggagcggat
gcgattttgctcattgcctccgtgctggatgtgttcgcactgaaaaaactgatggcggtg
gcggagatgttcgggttgcaatgcctggtggaggtacgcagcgagtcgcaggtgcgcgat
gcattgcgcgcgggcgcgcgcgtggtgggggtaaacaaccgcaacctcgccacgttcgat
gtcgatctgtccacgtccgcgcgcttccggcaccttttcccagaggatgtggttttcgtt
tccgaaagcggcattgccacggcggaagatatgaaacaggccgcagatctgggggcggat
gcggtactcatcggcgaaacgctgatgcgtgcccccgacattcacgcgaaactgaaggaa
ttacggtcattaacgcatggttaa

DBGET integrated database retrieval system