KEGG   Ethanoligenens harbinense: Ethha_1326Help
Entry
Ethha_1326        CDS       T01384                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00260  Glycine, serine and threonine metabolism
eha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eha01100  Metabolic pathways
eha01110  Biosynthesis of secondary metabolites
eha01130  Biosynthesis of antibiotics
eha01230  Biosynthesis of amino acids
Module
eha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ethha_1326
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ethha_1326
Enzymes [BR:eha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ethha_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADU26866
UniProt: E6U699
Position
1443924..1444721
Genome map
AA seq 265 aa AA seqDB search
MTDRIGEMFAKQKQAGKKALITFVTAGDPDIAATEKLVLAMEQAGADLVELGVPFSDPVA
EGPVIQAANIRALSNGLKIDGVFDAVARLREKTQVPLVFLMYINSIFNYGKENFFKRCRE
TGVDGVIIPDLPYEEKDEVADPAAKNGIKLISLVAPTSHERIQKIAEQAEGFLYCVSSLG
VTGTRSSFHTDFESFFSLINRYTAAPTALGFGISSPEQARELKRYADGIIVGSAIVRLVG
AAATPEDAVKSVADFTASLRAGLDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccgtatcggcgaaatgttcgccaaacagaagcaggcaggcaaaaaagcgctg
atcacattcgtgacagccggggaccccgatatcgccgccactgaaaagctggtgctggca
atggaacaggcgggagccgatctggtggaattgggcgtgccgttttccgacccggtggcg
gaggggccggtcattcaggctgccaacatccgcgcgctctccaacggattgaagatcgac
ggcgtgttcgacgcggtggcgcgcctgcgtgaaaaaacgcaggtcccgcttgtatttttg
atgtacatcaacagcatcttcaattatggaaaagaaaatttcttcaaacggtgccgcgag
accggcgtggacggcgtcatcatccccgatctgccctatgaggagaaggatgaagtggct
gatccggccgcgaagaacgggatcaagctgatctcgctggtggcgcctacctcacacgag
cgcatccagaagatcgcggagcaggcggaggggttcctctattgcgtgtcctctcttggt
gtgacgggcactcgcagttcgtttcacaccgattttgaatcgttcttctcactcatcaac
cgttacaccgccgcgcccaccgcactgggcttcggcatctcgtcgccggagcaggcgcgc
gaactcaaacgctatgcggacggtatcatcgtaggcagcgccatcgtgcgactggtgggt
gccgcggccacaccggaagatgccgtgaaaagcgtcgcagactttaccgcatcgctgcgt
gcgggactggacagctga

DBGET integrated database retrieval system