KEGG   Ethanoligenens harbinense: Ethha_1736Help
Entry
Ethha_1736        CDS       T01384                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00561  Glycerolipid metabolism
eha00640  Propanoate metabolism
eha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Ethha_1736
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Ethha_1736
Enzymes [BR:eha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Ethha_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ADU27263
UniProt: E6U9A4
Position
complement(1871445..1872533)
Genome map
AA seq 362 aa AA seqDB search
MLKLFRAPHNYVQGKDALLETYDNVKDFGKSFLFVCSRSAHKQARPVIEKSFEGKENKLI
FEIFGGISSNGEIERMRQIVRENDIDVVCGVGGGSAIDTAKATAYYEHRPVVIIPTVAAT
DAPCTGLSVIYNDDGSFDKYIFYPKNPDVVIVDTTILSKAPVKFLVAGMGDALGTYFEAR
ACVASNAPSLENGGVTKSAMALCELCYETLLRDGLKAKQAVERGLLTPAVESIIEANTFL
SGVGADNGGLAVSHSVYNGFTALEECEKTQHGSIVAFGTIAQLLLENADLEEIGEVVHFC
ISVSLPVTLEQIGVTDVERVHIAAEKACAPGESIHNLLGDVTPDALYDALLAADALGKTY
LQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaattattcagagcaccccataactatgtgcaggggaaagacgctttactcgag
acctatgacaatgtgaaagattttggcaaatcttttttgttcgtgtgcagccgcagtgcg
cataagcaggcgcgcccggtaatcgaaaaaagcttcgagggcaaagaaaacaagctgatt
tttgaaattttcggcggcatcagttccaacggcgaaatcgagcggatgcgtcagatcgtg
cgtgaaaacgacatcgacgtcgtctgcggcgtgggcggcggcagcgccatcgacaccgcg
aaggcgacggcctattatgagcaccgcccggttgtcatcatcccgaccgttgcggcgacc
gacgcgccctgcaccggcctttcggttatctacaacgacgacggttcgttcgataagtac
attttctatcccaaaaaccccgatgtggtcatcgtggataccaccattctctccaaagcg
ccggttaaattccttgtggccggtatgggcgacgcgctgggcacttattttgaagcccgc
gcctgcgtggccagcaacgcccccagcctggaaaacggcggcgttaccaaatccgctatg
gcgctctgcgaactctgctatgagactctgctgcgcgacggcctgaaagccaagcaggcg
gtggaacggggcctgcttaccccggcggtggaaagcatcatcgaagccaataccttcctg
agcggcgtgggtgcggacaacggcggtctcgcggtctcgcattcggtatacaacggcttt
acggcattggaggaatgtgaaaagacccagcacggcagcatcgtcgcgttcggtaccatc
gcgcagctcctgctggaaaacgccgatctggaagagatcggcgaagtggtgcatttctgc
atctccgtcagcctgccggtcacgttggagcagatcggtgtcaccgatgtcgaacgtgtg
cacatcgcggcggaaaaagcctgcgcgccgggcgagtccatccacaacctgctgggcgac
gtgacgccggacgcgctgtatgatgcgctgctcgccgcggatgcgctgggcaagacctac
ctgcagtaa

DBGET integrated database retrieval system