KEGG   Ethanoligenens harbinense: Ethha_2118Help
Entry
Ethha_2118        CDS       T01384                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00230  Purine metabolism
eha01100  Metabolic pathways
Module
eha_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ethha_2118
Enzymes [BR:eha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ethha_2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 MMR_HSR1 AAA_22 cobW Rad17 AAA_29 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADU27635
UniProt: E6U3N5
Position
complement(2266659..2267255)
Genome map
AA seq 198 aa AA seqDB search
MPERGLLLVVSGPSGAGKGTVIEELFRRRAGLFYSISATTRAPRPGEVDGEQYYFLSKEE
FEQEIAQDNMLEYARYCENYYGSPRGPVEDKRAQGLDVILEIEVQGAMKVRHNCADATLV
FIMPPSIEELAKRLRGRGTESEDVVRRRLETSKAEIQTASAYDYIVLNDEVERAARDVDC
IITAEKLRSQRYTGGFLA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacgcgggctgctgcttgtggtttccggaccgtccggcgccggaaaaggcacg
gtgattgaggagcttttccggcgccgcgccggtctgttctactccatttcggccaccacg
cgcgccccccgtccgggcgaagtggacggcgagcagtattatttcctttccaaagaggaa
ttcgaacaggaaatcgcgcaggacaatatgctggaatatgcgcgttactgcgagaattat
tacggttcgccgcgcggcccggtggaagacaaacgtgcgcaggggctggatgtgatcctt
gaaatcgaggtgcagggcgccatgaaggtccgccacaactgcgccgacgctacgctggtc
ttcatcatgccaccgtccattgaggaactggccaaacgcctgcgcgggcgcggcactgaa
agtgaggacgtggtgcgcaggcggttggagacctccaaggcggaaatccagacggcgagc
gcctacgattatatcgtgctcaacgacgaggtggagcgcgccgcgcgcgatgtggattgc
atcatcaccgccgaaaagctgcgctcgcagcgctacacaggcgggtttctggcataa

DBGET integrated database retrieval system