KEGG   Ethanoligenens harbinense: Ethha_2598Help
Entry
Ethha_2598        CDS       T01384                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
eha  Ethanoligenens harbinense
Pathway
eha00450  Selenocompound metabolism
eha00970  Aminoacyl-tRNA biosynthesis
eha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Ethha_2598
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ethha_2598
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eha01007]
    Ethha_2598
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eha03016]
    Ethha_2598
Enzymes [BR:eha01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Ethha_2598
Amino acid related enzymes [BR:eha01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Ethha_2598
Transfer RNA biogenesis [BR:eha03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Ethha_2598
 Prokaryotic type
   Other AARSs
    Ethha_2598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD PTPA
Motif
Other DBs
NCBI-ProteinID: ADU28091
UniProt: E6U721
Position
complement(2782085..2784040)
Genome map
AA seq 651 aa AA seqDB search
MKKTYYITTPIYYTSGTLHIGHGYTTVAGDAMARFRRMQGYDVLFLTGTDEHGQKIEERA
EAAGKTPKAYVDEIVAEIKSLWKLLDISYDRFIRTTDAAHEKVVQQIFRRLYEQGDIYKG
KYEGWYCRPCESFWTETQLKDGKCPDCGREVKRAEEEAYFFRLSKYADRLVEHYKAHPEF
ISPPSRMHEMVNNFIKPGLEDLCVSRTSFTWGIPVDFDPGHVIYVWIDALSNYITALGYG
TENDADYRKYWPADVHLMAKEIVRFHTIIWPAILMALGEPLPKRVFGHGWLLLGGDKMSK
SKGNVVDPVLLCKRYSVDAIRYFLLREIPFGADSTFSTEALLGRINADLANDLGNLVSRT
VAMVEKYFGGVLPAAGESGPFDDKLRALAAETAKAVEADMDAFQFSNALADIWKFVSRTN
KYIDETAPWILAKNEADKPRLAQVLRNLCESVRLISVCIAPFMPATAAEIRRQLGLPEGV
PDWSDTARFDVLPDGLRVQKGAALFPRLDIPAELEALAQITPGPAETPTAEADAKKADDA
PAGVARIGIDEFGKVELRVAEIKAAEKIKKSKKLLRLELDVGGEARQVVSGIAQWYAPED
LPGKKIILVANLAPAKLCGVESQGMILAADDGAAARVLFVDGAIPSGAKVR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacctattatatcaccacccctatttattacacgtccggcacgctgcacatc
gggcatggctacaccacggtggcgggggacgcgatggcgcgctttcggcggatgcagggt
tacgacgtgctgttcctcaccggtacggatgagcatggccagaagatcgaggagcgggct
gaggctgcgggcaagaccccgaaagcatacgttgatgagatcgtggcggagatcaagtcg
ctctggaagctgcttgatatatcctatgaccggtttattcgcaccaccgacgcggctcat
gaaaaagtggtgcagcagatcttccggcggctgtatgagcagggcgatatctataaaggc
aaatacgagggctggtactgccgcccctgcgagtcgttctggacggagacgcagctcaag
gacggaaagtgtcccgactgcggccgcgaggtgaaacgggcggaggaggaagcctatttc
ttccgcctttccaaatatgccgaccggcttgtcgagcattacaaagcgcatccggagttc
atctcgccgccctcgcgcatgcacgagatggtcaacaacttcatcaagcccgggttggag
gacctctgcgtgtcgcgcacatcgtttacttggggcatcccggtggatttcgaccccggc
catgtcatctatgtctggatcgacgcgctcagcaactatatcaccgcgctgggctacggc
acggagaacgatgcggactaccgcaaatactggcccgccgacgtgcacctgatggccaaa
gagatcgtgcggttccacaccatcatctggccggctatcctgatggcgctgggcgagccg
ctccccaagcgcgtgttcgggcacgggtggctgctgttgggcggggataagatgtccaaa
tccaagggcaatgtggtcgatcccgtgctgctctgcaagcggtacagtgtggacgccatc
cgctacttcctgctgcgggagatcccgttcggggcggacagcacgttttccaccgaggcc
ctgcttggccgcatcaacgccgacctggccaacgatctgggcaatctcgtttcccgcacg
gtggcgatggtggagaagtatttcggcggcgtattgcccgccgcaggagaatccggcccg
ttcgacgacaagttgcgtgcgctggcggccgaaacggctaaagccgtggaagcggatatg
gatgcgttccagttttccaacgcgctggcggatatctggaagtttgtttcccgcaccaac
aaatacattgatgagaccgcgccgtggatactggccaaaaacgaggcggataagccccgg
ctggcgcaggtgctgcgcaacctctgcgaatcggtgcggttgatctccgtctgcatcgcg
ccgttcatgcccgctaccgcggcggagatcagaagacagctcggcttgcctgaaggcgtg
cccgactggtcggacaccgcacggttcgatgtgctgcccgacggcctgcgtgtgcaaaaa
ggggcggcgctgttccctcggctggacattccggctgagttggaagcgctggcgcagatc
acgcccggcccggcggaaactccgaccgccgaagcggacgcgaagaaagcggatgacgcg
cctgcgggcgtggcgcgcatcggcatcgacgagttcggcaaagtggagttgcgcgtggcc
gagatcaaagccgccgaaaaaattaaaaaatcgaaaaaactgcttcggttggaactggat
gtgggcggcgaagcgcgccaggtggtttcgggcatcgcgcaatggtatgcgccggaagac
ctgcccggtaaaaaaatcatattggtcgcaaatctcgcgcccgccaaactctgcggggtg
gagagccaggggatgattctggcggccgacgacggtgccgccgcgcgtgtactgtttgtg
gacggcgctattccttccggcgcgaaggtccggtaa

DBGET integrated database retrieval system