KEGG   Encephalitozoon hellem: EHEL_041310Help
Entry
EHEL_041310       CDS       T02287                                 

Definition
(RefSeq) CutA-like divalent cation tolerance protein
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
ehe  Encephalitozoon hellem
Brite
KEGG Orthology (KO) [BR:ehe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EHEL_041310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-GeneID: 13468048
NCBI-ProteinID: XP_003887162
UniProt: I6UC98
Position
IV:complement(157514..157852)
Genome map
AA seq 112 aa AA seqDB search
MPHLLIVFTTYPSQESAEKASCDLITRRLAACCQISQVTSIYPWKGNVERETEYKLTIKT
FTCLFNMVKKLIEESHPYEVPEIVGIEAHSASGRYSEWMELCMDVPSKGDAL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgccacatttgctcattgtctttacaacatatccatcccaggagtctgcggaaaaggct
tcgtgcgacttaataactaggaggcttgctgcttgctgccagatatcccaggtgacatcc
atctatccgtggaaaggaaacgttgaaagggaaacagagtacaaattgactataaaaaca
ttcacctgtttatttaatatggtcaagaagcttatagaagaaagccacccgtatgaagtt
cctgaaattgttggcatagaggcacattcagcatctgggaggtattcagaatggatggaa
ctctgcatggatgtccccagtaagggagatgcgttgtag

DBGET integrated database retrieval system