KEGG   Encephalitozoon hellem: EHEL_111700Help
Entry
EHEL_111700       CDS       T02287                                 

Definition
(RefSeq) polyprenyl synthetase domain-containing protein
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
ehe  Encephalitozoon hellem
Pathway
ehe00900  Terpenoid backbone biosynthesis
ehe01100  Metabolic pathways
ehe01110  Biosynthesis of secondary metabolites
ehe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ehe00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EHEL_111700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ehe01006]
    EHEL_111700
Enzymes [BR:ehe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     EHEL_111700
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     EHEL_111700
Prenyltransferases [BR:ehe01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   EHEL_111700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 13466882
NCBI-ProteinID: XP_003888424
UniProt: I6UPY5
Position
XI:200908..201786
Genome map
AA seq 292 aa AA seqDB search
MVKEIVKNKILEMSGNSNRSDVSFLLDYNLDGGKELRYKAYIHVLKELKGEMCEKNLIAG
YSIELLQAALLIVDDLMDNSEIRRGRPCYYLKRGAKTLKDAFFLLAAIRNLLDEKARSAY
SGPVLKTCLGQTHDTIRKTRSEYNIETYTAIAESKTGAYTFYLPTILGYVSARKKEPSRL
WDFCNLGALIFQMQDDYLNFLPEKSAKSMNDLEEMKCTWFTSKISHMEGPSIEKYFSEGV
VSPDLVSIVKGLFKEYFLNLDELLDKLISMTNEDEKTVLDVFISFLESRRNF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaggaaatagtaaaaaataagattttagaaatgtctggaaacagcaacagatcg
gacgtctcctttctcctggattataatctagatggaggcaaggagctgagatacaaagcg
tacatccatgttctaaaagagctaaaaggtgagatgtgtgaaaagaatcttatcgcagga
tattctatagaattgctacaagcagcattgttgattgtcgatgacctaatggacaattct
gaaataagaaggggtaggccgtgctattatcttaaaagaggagccaagacactcaaagat
gctttttttcttctagcagctataagaaacctgctggacgaaaaagcaaggagtgcctat
tcaggcccagtattaaaaacctgtcttggacaaacacacgatacaatcagaaaaacgagg
tcagagtacaatattgagacatatacggccatagcggagagcaaaacaggcgcgtatact
ttctacctacccacgattcttggatatgtatctgccagaaagaaagagcctagccgcctt
tgggacttttgcaatcttggagccttgatcttccagatgcaagatgattatctgaacttc
cttccagaaaagtctgcgaagtcgatgaatgatcttgaggagatgaagtgcacctggttt
acctcaaagatatcacacatggaaggtccttctattgaaaagtacttttcagagggggtg
gtgtctccggatctggttagtatcgtcaaaggtctctttaaagagtatttccttaatctt
gacgagttattggataagcttatttccatgaccaacgaagatgagaagacagtgctagat
gtcttcatttcctttcttgagtcaagaagaaacttttga

DBGET integrated database retrieval system