KEGG   Ehrlichia sp. HF: EHF_0361Help
Entry
EHF_0361          CDS       T03078                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EHF_0361 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ehh03011]
    EHF_0361 (rplV)
Ribosome [BR:ehh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EHF_0361 (rplV)
  Bacteria
    EHF_0361 (rplV)
  Archaea
    EHF_0361 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHX05093
UniProt: X5GKZ8
Position
391552..391899
Genome map
AA seq 115 aa AA seqDB search
MSKEVSIMAKGIGLRSTPSKLNLVADLIRGKDVSVAIMYLKFCKKKSAGYISKVLKSAIA
NAQANYNVDLDNLYVKEVLVGKSFSLRRIHARARGKACRVHKHYGNVIIKLFERM
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaagtatcgataatggctaaaggtattgggctaagatctactccttccaaa
ttaaatttggttgctgatttgattagaggaaaagatgtatctgtagctataatgtattta
aaattttgtaaaaagaagtctgctggatatatcagtaaggttttaaaatctgctattgcc
aatgcgcaagctaattataatgttgatcttgataatctttacgtaaaagaagttctggtt
ggaaagtctttttctttacgtaggattcatgctcgtgcacgaggtaaagcatgtagagtg
cataagcattatggtaatgttatcataaaattatttgagaggatgtaa

DBGET integrated database retrieval system