KEGG   Ehrlichia sp. HF: EHF_0505Help
Entry
EHF_0505          CDS       T03078                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ehh  Ehrlichia sp. HF
Pathway
ehh00900  Terpenoid backbone biosynthesis
ehh01100  Metabolic pathways
ehh01110  Biosynthesis of secondary metabolites
ehh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ehh00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EHF_0505 (dxr)
Enzymes [BR:ehh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     EHF_0505 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: AHX04794
UniProt: X5H1R3
Position
553056..554174
Genome map
AA seq 372 aa AA seqDB search
MIIDIIFADLDKYQVKVLVAKSNVQLLAFQAKLVNAERVVIADVDLYQELKDLLVGTNIK
VSAGDSGMVMATSLNVDYAMMAIVGIAALIPMTYLINSNVKVIALANKESIVCGGTLLLS
LAKEKDVNIIPVDSEHNAIHQIFSNNDKRDLEKVTLTASGGPLLSMDYNQMKNVTVQDTV
KHPIWKMGKKISVDSATMINKSLEVIEAYYFFSIKAEKLDIIIHPESVVHGIVSYIDGTS
IAVMSVPDMKIPIMYTLSWPDRSSVLCRKLNLALYNQLTFIKPDVYKFPGIKLGFEVLKT
SNVPANSIILNAANEVAVDAFLNKKIGFLDIISVLYETLNLVNYGRINSLSSILDCDAVT
RRVASNIVDKLR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatataatatttgctgatctcgataaatatcaagtaaaggtattagttgca
aaatcaaatgttcagttattagcatttcaggctaagttagttaatgcagaaagagttgtt
attgctgatgttgatttgtatcaagaattaaaagatttattggttggtactaatattaaa
gttagtgctggagattctgggatggttatggctacatctttaaatgtagattatgcaatg
atggctattgtaggaatagcagcgcttataccgatgacttatttaattaattcgaatgtt
aaagttattgcattagcaaacaaagaaagtatagtttgtggaggaacattattacttagt
ttagcaaaagaaaaggatgttaatattattcctgtagattcagaacacaatgctatacat
cagatattttctaataatgataaaagggatttggaaaaagttactttaactgcatctggt
ggtccattattatcaatggattataatcaaatgaaaaacgtgacagttcaggatacagtt
aagcatcctatttggaagatggggaaaaaaatatctgttgatagtgcaactatgatcaat
aagtctcttgaagttatagaggcttattattttttttcaataaaagctgaaaaactagat
ataattatacatcctgaatctgtagtgcatgggatagtatcttatatagatggtacatct
attgctgttatgtctgtaccagatatgaaaattccaattatgtatacattatcttggcca
gataggtcatctgttttgtgtagaaaactgaatttagcattatataatcagttgactttt
ataaaacctgatgtttataagtttcctggtataaaattagggtttgaggtattaaaaaca
tctaatgttcctgctaatagcattattttaaatgctgcgaatgaagttgctgttgatgct
ttcttgaataagaaaatagggtttcttgatattataagtgtactctatgaaacattaaac
ttagttaattatggtcgtattaattctctatcaagtattcttgattgtgatgcagtaact
agaagggtagcaagtaatattgttgataaattgcgttaa

DBGET integrated database retrieval system