KEGG   Entamoeba histolytica: EHI_052860Help
Entry
EHI_052860        CDS       T00238                                 

Gene name
218.t00008
Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ehi  Entamoeba histolytica
Pathway
ehi03040  Spliceosome
ehi04141  Protein processing in endoplasmic reticulum
ehi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EHI_052860 (218.t00008)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EHI_052860 (218.t00008)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    EHI_052860 (218.t00008)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ehi01009]
    EHI_052860 (218.t00008)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ehi03041]
    EHI_052860 (218.t00008)
   03009 Ribosome biogenesis [BR:ehi03009]
    EHI_052860 (218.t00008)
   03110 Chaperones and folding catalysts [BR:ehi03110]
    EHI_052860 (218.t00008)
   04131 Membrane trafficking [BR:ehi04131]
    EHI_052860 (218.t00008)
   03051 Proteasome [BR:ehi03051]
    EHI_052860 (218.t00008)
   03029 Mitochondrial biogenesis [BR:ehi03029]
    EHI_052860 (218.t00008)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ehi04147]
    EHI_052860 (218.t00008)
Protein phosphatases and associated proteins [BR:ehi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EHI_052860 (218.t00008)
Spliceosome [BR:ehi03041]
 Complex B
  Other components
   Prp19 complex
    EHI_052860 (218.t00008)
 Complex C
   Prp19-CDC5 complex
    EHI_052860 (218.t00008)
Ribosome biogenesis [BR:ehi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    EHI_052860 (218.t00008)
Chaperones and folding catalysts [BR:ehi03110]
 Heat shock proteins
  HSP70 / DNAK
   EHI_052860 (218.t00008)
Membrane trafficking [BR:ehi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    EHI_052860 (218.t00008)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EHI_052860 (218.t00008)
Proteasome [BR:ehi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EHI_052860 (218.t00008)
Mitochondrial biogenesis [BR:ehi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    EHI_052860 (218.t00008)
Exosome [BR:ehi04147]
 Exosomal proteins
  Proteins found in most exosomes
   EHI_052860 (218.t00008)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A FGGY_C FeoB_Cyto
Motif
Other DBs
NCBI-GeneID: 3404756
NCBI-ProteinID: XP_650458
UniProt: C4M3S5
AA seq 656 aa AA seqDB search
MSKYTGPAVGIDLGTTYSCVGIWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
IAMNVKNTVFDAKRLIGRRFSDPAIQNDMKHWSFKVIDDGHDKPLIEVEYKGEVKKFTPE
EISSMVLTKMKETAESFVGKEVKNAVITCPAYFNDSQRQATKDAGTIAGMNVMRIINEPT
AAAIAYGLDKKSDREKNVLIFDLGGGTFDVSLLAIDDGVFEVKATNGDTHLGGEDFDNRL
VNHFIAEFKRKYKKDISGNARAVRRLRTACERAKRTLSSAATANIEVDQLFDGIDFYTSI
TRARFEELNIDLFKSTIGPVERVLQDAKLDKGSIDDVVLIGGSTRIPKVVQLLQDFFNGK
EPNKSINPDEAVAYGAAVQAAILTGTGGKATEDVLLLDVAPLTLGIETAGGVMTALIPRN
STIPAKKSQVFSTYADNQPGVLIQVFEGEASMTNHCNLLGKFELTGIPPAPRGVPQIEVT
FDIDANGILNVSAEDKTTGKKNKITITNDKGRLSKEQIDKMVAEAEKFKAEDDKMKQRVE
AKNKLENFCYSVKNTLSEQFADKIAAEDKTTIENIVKETLDWIDNNQNASTEEYDNKMKE
VEGKVQPIFTKLYQQAGAAGGMPGGMPNGFPGAGAAPQGNAQPKSSGKGPTIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatacacaggaccagccgttggtattgatttaggtactacatattcatgtgta
ggtatctggcaaaacgatagagttgaaattattgctaatgatcaaggaaatagaacaaca
ccatcatatgttgcatttactgatacagaaagacttattggagatgcagcaaagaaccaa
attgcaatgaatgttaaaaacactgtatttgatgcaaagagattaattggaagaagattt
agtgatccagcaattcaaaatgatatgaaacattggtcattcaaagttattgatgatgga
catgataaaccattaattgaagtagaatacaaaggagaagttaagaaattcaccccagaa
gaaatttcatcaatggtattaactaaaatgaaagaaacagcagaatcatttgttggaaaa
gaagtaaagaatgcagttattacatgtccagcatatttcaatgattctcaaagacaagct
actaaagatgcaggaacaattgcaggaatgaatgtgatgagaattattaatgaaccaact
gcagcagctattgcatatggacttgataaaaagagtgacagagaaaagaacgttcttatt
ttcgatcttggaggaggaacatttgatgtatcattacttgcaattgatgatggagtattt
gaagttaaagcaactaatggagatacccatcttggaggagaagattttgataatagactt
gtcaatcattttattgctgaattcaagagaaaatataagaaagatattagtgggaatgca
agagctgttagaagattaagaacagcatgtgaaagagcaaaaagaacattatcaagtgct
gcaacagcaaacattgaagttgatcaattatttgatggaattgacttttatacatctatt
acacgagctagatttgaagaattaaatattgatttatttaaatcaactattggaccagtt
gaaagagttttacaagatgctaaattagacaaaggatcaattgatgatgttgtcttaatt
ggaggaagtacaagaattccaaaagttgttcaattattacaagatttcttcaatggaaaa
gaaccaaacaaaagtattaatccagatgaagcagttgcatatggagcagcagtacaagca
gctatcttaacaggaaccggaggaaaagcaacagaagatgtgttattacttgatgttgca
ccacttacacttggaatagaaacagcaggaggagttatgacagcattaattcctagaaat
tcaacaattccagcaaagaaatcacaagtattctctacatatgcagacaatcaaccagga
gtattaattcaagtatttgaaggagaagcatcaatgacaaaccattgtaatttacttgga
aaattcgaattaacaggaataccaccagcaccacgaggagtaccacaaattgaagttaca
tttgatattgatgcaaatggtattttgaatgtttcagcagaagataaaacaactggaaag
aagaataagattactattactaatgacaaaggaagattaagtaaagaacaaattgataag
atggtagcagaagctgaaaagttcaaggcagaagatgataagatgaaacaaagagtcgaa
gcaaagaataagttagagaacttctgttattcagtcaagaatactcttagtgaacaattt
gctgataagattgctgcagaagataagactactattgagaatattgttaaagaaactctt
gattggattgataacaatcaaaatgcttccactgaagaatatgataacaagatgaaggaa
gttgaaggaaaagtccaaccaattttcactaagctctatcaacaagccggagctgctggt
ggaatgccaggaggaatgccaaatggattcccaggtgctggagctgctccacaaggtaac
gctcaaccaaagtcaagcggaaaaggaccaactattgaagaagttgattaa

DBGET integrated database retrieval system