KEGG   Entamoeba histolytica: EHI_059910Help
Entry
EHI_059910        CDS       T00238                                 

Gene name
101.t00003
Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00010  Glycolysis / Gluconeogenesis
ehi00562  Inositol phosphate metabolism
ehi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_059910 (101.t00003)
   00562 Inositol phosphate metabolism
    EHI_059910 (101.t00003)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     EHI_059910 (101.t00003)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     EHI_059910 (101.t00003)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 GNAT_acetyltran ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 3407212
NCBI-ProteinID: XP_652901
UniProt: C4M349
AA seq 426 aa AA seqDB search
MLAVLLVNMALGCCGYNEDITHCLSTRTPYLLKDIRDPTLDHFTVVHAELVQRHGSRYPT
SNDINAMNMMAETFAENSKITWKNPFPMEMEGELCDRGKQELFSLGKYYKGEFKKLFYGK
SLLNINVTATFKKRTQDSAISWLEGFYDDEPEKKQMVIDNKINITVVPKDKDTQLYFHKN
CRRYVEYEKSSSTHKQSNQYAQMKLNETANRFIKAIGMTDIDESTSKSLTQLAFTAGAHE
YVVFNKSDGLLKYFNIRDAHIMEYIKDLETYYTKGNSSELNYKIAIPLLDSIINGLKLAV
VNDKNIQLTKQENNILGNFRFAHAETVTPLMTLMGVNIDQFALTVKLNEAKKNQRKWNMS
KVSPYSVHFMFVLLKSKKGQYYVRTYFNQEAIVLPPCGSEICLFEDFVKYYGKITKDFDY
NTFCSN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgttcttctagtgaacatggcccttggctgttgtggctataacgaagatata
acccattgtttaagtactagaacaccctacttactcaaagatatcagagacccaacgctg
gaccatttcactgtggttcatgcagagttagtccagcgacatggctctcgatatccaaca
tcaaatgacataaatgcaatgaatatgatggctgaaacatttgctgaaaattctaaaatt
acatggaaaaacccatttccaatggaaatggaaggagagttatgtgacagaggaaaacaa
gaattatttagtttgggaaaatattataagggtgaatttaaaaagttattttatgggaaa
tctttacttaatattaacgttactgctacctttaaaaagaggactcaagatagtgctata
agttggttagaagggttttatgatgatgaacctgaaaaaaaacaaatggttattgataac
aaaataaatattactgttgttcctaaagacaaagacactcagttgtactttcataaaaat
tgtagaagatatgttgaatatgaaaaaagtagttcaacacataaacagtctaaccaatat
gctcaaatgaaattaaatgaaacggcaaatagatttataaaagcaattggaatgactgat
attgatgaaagtactagtaaaagtcttacacaacttgctttcactgctggagcacatgag
tatgttgtatttaataaaagtgatggactattaaagtattttaatattagagatgcacat
ataatggagtatatcaaagacttagaaacatattatacaaaaggtaattctagtgagtta
aattataaaattgcaatccctcttttggactctattattaatggattaaaattagctgtt
gtaaatgataaaaatattcaattaacaaaacaggagaataatattcttggtaattttaga
tttgcacatgcagaaactgttactcccttaatgactttaatgggagttaatattgatcaa
tttgctttaactgtaaaattaaatgaagcaaaaaagaatcagagaaaatggaatatgtct
aaggttagtccatatagtgtccatttcatgtttgttcttctaaaatcaaaaaaaggacaa
tattatgtaagaacttattttaatcaagaagctatagttttacctccttgtggatcagaa
atttgtttatttgaggattttgtgaagtactatggaaaaattacaaaagactttgattat
aatacattttgttcaaattaa

DBGET integrated database retrieval system