KEGG   Entamoeba histolytica: EHI_088460Help
Entry
EHI_088460        CDS       T00238                                 

Gene name
281.t00004
Definition
(RefSeq) HAD hydrolase, family IA, variant 3
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
ehi  Entamoeba histolytica
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ehi01009]
    EHI_088460 (281.t00004)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     EHI_088460 (281.t00004)
Protein phosphatases and associated proteins [BR:ehi01009]
 HAD phosphatases
  Other HAD phosphatases
   EHI_088460 (281.t00004)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Acid_PPase
Motif
Other DBs
NCBI-GeneID: 3403954
NCBI-ProteinID: XP_649654
UniProt: C4MA15
AA seq 229 aa AA seqDB search
MSETPQIKYAIFDLDGTLLDTEILYTIVTQQYLDEYANGAKFTYEIKKEMMGRHIEVATK
WLMDIFHINDTLEHAIQYKIDHLNKLWSTVKPLPGAMKILNYFKKHHIPIALATSTTKSV
FEQKMVKNQEMLNYFDAIVLGDDPHVKEAKPNPQIFLHAGHLLGCTDMKQAIVFEDAVLG
VQAGIASGAYTVAIPDKECANDPYFEKAYVQLKSLNEFEPTKFGLPNDY
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaactccacaaataaaatatgcaatctttgatcttgatgggacactacttgat
acagaaatattatatacaattgttactcaacaatatttagatgaatatgctaatggagct
aaatttacttatgaaattaaaaaagaaatgatgggaagacatattgaggttgctactaaa
tggttaatggatatttttcatattaatgacacacttgaacatgcaatacaatataaaatt
gatcatttaaataaattatggtcaacagtaaaaccattaccaggagcaatgaagatttta
aattattttaaaaaacatcacattcctatagctcttgctacttcaaccactaaatctgtc
tttgaacaaaaaatggttaaaaaccaagagatgctcaattattttgatgcaattgttctt
ggagatgatcctcatgtaaaagaagctaaaccaaatccacaaatatttttacatgctggt
catttacttggatgtactgacatgaaacaagcaattgtatttgaagatgcagtacttggt
gttcaagcaggaattgcatctggagcttatactgtagctattccagataaagaatgtgca
aatgatccttattttgaaaaagcatatgtgcaattgaaatcacttaatgaatttgaacca
acaaaatttggacttccaaatgattattga

DBGET integrated database retrieval system