KEGG   Entamoeba histolytica: EHI_118910Help
Entry
EHI_118910        CDS       T00238                                 

Gene name
62.t00003
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00230  Purine metabolism
ehi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EHI_118910 (62.t00003)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     EHI_118910 (62.t00003)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 ABC_tran AAA_33 ATPase_2 RNA_helicase AAA_22 RsgA_GTPase MMR_HSR1 AAA_16 AAA_17 AAA AAA_29 CoaE NTPase_1 AAA_28 AAA_14 TsaE AAA_30 AAA_24 Roc AAA_23 Rad17 cobW AAA_5 NACHT KTI12 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 3408444
NCBI-ProteinID: XP_654104
UniProt: C4LYN9
AA seq 186 aa AA seqDB search
MGKYQVLVLFGPSGAGKSTIMHHLMEKFPGKFSFSISHTTRKPRGKEQNGVDYYFIEEEE
MKKMIEEDKFIEHAHVHTAFYGTSKMEIERIANNNQIAILDIDLQGSRQIRGKVAAFFLF
IAPPSMEILEQRLRSRGTETEEQVQVRLKNALIEMEGEKEADAVVVNNVFTEGYGKIDEI
IEKNLF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatatcaggttcttgttctttttggtccaagtggagcaggtaaatcaacaata
atgcaccatcttatggaaaaatttcctgggaaattttcatttagtatttcacacacaaca
agaaaaccaagaggtaaagaacaaaatggtgttgattattactttattgaagaagaagaa
atgaagaaaatgattgaagaagataaatttattgaacacgcccatgttcatacagccttc
tatggtacttcaaaaatggaaattgaacgcattgctaataataatcaaattgcaattctt
gatattgatcttcaaggaagtagacaaattagaggtaaagtggcagcattctttttgttt
attgcacctccttcaatggaaattttagaacaacgtttacgttcaagaggtacagaaaca
gaagaacaagtccaagttcgtttaaagaatgcacttattgaaatggaaggagaaaaagaa
gcagatgcagtagttgtgaataatgtattcacagaaggatatggtaagatagatgaaatt
atagaaaagaatttgttttaa

DBGET integrated database retrieval system