KEGG   Entamoeba histolytica: EHI_143430Help
Entry
EHI_143430        CDS       T00238                                 

Gene name
121.t00024
Definition
(RefSeq) 60S ribosomal protein L39
  KO
K02924  large subunit ribosomal protein L39e
Organism
ehi  Entamoeba histolytica
Pathway
ehi03010  Ribosome
Module
ehi_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EHI_143430 (121.t00024)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ehi03011]
    EHI_143430 (121.t00024)
Ribosome [BR:ehi03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    EHI_143430 (121.t00024)
  Archaea
    EHI_143430 (121.t00024)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L39
Motif
Other DBs
NCBI-GeneID: 3406675
NCBI-ProteinID: XP_652366
UniProt: C4LTA2
AA seq 51 aa AA seqDB search
MTGHKGFSYKLKLGKKIHQNRGVPQWFRMKTGNTINYNFKRRHWNRRKMGM
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgactggacacaagggtttctcatacaaattaaaacttggtaagaaaattcaccaaaac
agaggtgtcccacaatggttcagaatgaaaactggaaacactattaactataacttcaag
agaagacattggaacagaagaaagatgggcatgtaa

DBGET integrated database retrieval system