KEGG   Entamoeba histolytica: EHI_188730Help
Entry
EHI_188730        CDS       T00238                                 

Gene name
39.t00045
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
ehi  Entamoeba histolytica
Brite
Chromosome and associated proteins [BR:ehi03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    EHI_188730 (39.t00045)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EHI_188730 (39.t00045)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone YscO-like CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 3409286
NCBI-ProteinID: XP_654974
UniProt: C4LV75
AA seq 133 aa AA seqDB search
MSDKASQKKSVATKDATKPKKAGDEEKKTMLKKNFESYALYISRVLKSVFQDIGITLPSI
SIMDSFVRDIFERIATEASSLARNYNKTTITVKEIETATKLILKGDLNKHAVSEGQSAVK
RASGKGSTSGSQV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaaagccagtcaaaagaaatctgttgctactaaagacgctaccaagccaaaa
aaagctggagatgaagaaaagaaaactatgctcaagaagaattttgagtcatatgccttg
tacatttcaagagttttgaaatcagttttccaagatattggaattacacttccatctatt
tctattatggattcatttgttcgtgatatttttgaaagaattgctactgaagcttcatct
cttgcaagaaattacaataaaaccaccatcactgtcaaagaaattgaaacagccactaaa
cttattcttaaaggtgatttgaataaacatgcagtttctgaaggacaatcggctgttaag
agagcatctggtaaaggaagtacttcaggatctcaagtttaa

DBGET integrated database retrieval system