KEGG   Anaerobutyricum hallii: EHLA_1022Help
Entry
EHLA_1022         CDS       T05310                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
ehl  Anaerobutyricum hallii
Pathway
ehl00561  Glycerolipid metabolism
ehl00640  Propanoate metabolism
ehl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EHLA_1022
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    EHLA_1022
Enzymes [BR:ehl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     EHLA_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: SOB71756
UniProt: A0A285PRI0
Position
I:1118126..1119223
Genome map
AA seq 365 aa AA seqDB search
MANIIISPAKYVQGKGELANIAQYATKLGKKPFILISESGKKRVGGIIEDSFKETGCELV
FEAFHGECSKNEINRLVAIVKEKGCDMVIGVGGGKIFDTAKAVAYYVNSPVIVCPTIAAT
DAPCSALTVVYTDDGVFEEYLWLPANPNLVLVDTDIIAKAPARLLVSGMGDALATYFEAK
ACQASNATSCAGGHITIAAITLAKVCYQTLIEEGVKAKLAVEADVCTTAVEKVIEANTLL
SGMGFESGGLAGAHAIHNGLTCIKECHHLYHGEKVAFGTLTQLVLENADEDLLDEVITFC
MDVGLPTTFADLGIENPDKDALMEAATLAASPDDTLGNEPFEVTPEKVYAAMVAADALGR
YYKGF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacattattatcagtccagcgaagtacgtgcagggaaagggagagcttgcgaat
attgcgcagtacgctacaaagcttggaaagaagccttttattttaattagtgaaagcgga
aagaaacgtgttggtggaattatcgaagatagtttcaaagagacaggatgtgaacttgtt
tttgaagcatttcatggggaatgttctaaaaacgagattaaccgcctggttgctatcgta
aaagaaaaaggctgcgatatggttatcggtgtcggcggcggaaagatttttgatacagca
aaagccgttgcttattatgtgaacagtccggttatcgtatgtcctaccattgccgcaaca
gatgcaccttgttctgcccttactgtagtttatacagatgatggcgtatttgaagaatac
ttatggttaccggcaaatccaaatcttgttttagtagataccgatattatcgcaaaggct
ccggcgagactgttagtttccggtatgggtgatgcacttgcaacatattttgaagcaaaa
gcctgtcaggcaagcaatgcaactagctgtgcaggtggtcatattacaattgcagcgatt
actttggcaaaagtttgctatcagacattaatagaagaaggtgtaaaagcaaaacttgca
gtagaagctgatgtatgtactacagcagtagaaaaagtaattgaagcaaacacactgtta
tctggtatgggatttgaaagtggcggattagctggcgcacatgccatccataacggcctg
acatgtattaaagaatgtcaccatttatatcatggagaaaaagttgcatttggtacatta
acacagcttgtacttgagaatgccgatgaagatttattagatgaagtaattactttctgc
atggatgttggacttcctactacatttgcagatcttggaatcgagaatccagataaggat
gctcttatggaagcagcaacattagcagcttccccagatgacacattaggtaatgaacca
tttgaagttacaccagagaaggtatacgcagcaatggttgcagcagatgccttaggaaga
tactacaaaggtttttaa

DBGET integrated database retrieval system