KEGG   Enterobacter hormaechei CAV1176: AB284_09925Help
Entry
AB284_09925       CDS       T04593                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00130  Ubiquinone and other terpenoid-quinone biosynthesis
ehm00627  Aminobenzoate degradation
ehm01100  Metabolic pathways
ehm01110  Biosynthesis of secondary metabolites
ehm01120  Microbial metabolism in diverse environments
ehm01220  Degradation of aromatic compounds
Module
ehm_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AB284_09925
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AB284_09925
Enzymes [BR:ehm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     AB284_09925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ANS16939
UniProt: A0A4U1DYJ3
Position
1863387..1863956
Genome map
AA seq 189 aa AA seqDB search
MKRLIVGISGASGAIYGVRLLQVLRDVAGVETHLVMSQAARQTLSLETDLSLRDVQALAD
VVHDARDIAASISSGSFKTAGMVILPCSIKTLSGIVNSYTDTLVTRAADVVLKERRPLVL
CVRETPLHLGHLRLMTQAAELGAVIMPPVPAFYHRPQTLDDVINQTVNRVLDQFDIDLPE
DLFTRWQGA
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcattgtagggatcagcggtgccagcggcgcgatttatggcgtccggctg
ttacaggtgctgcgtgacgttgcaggcgtagaaacccatctggtgatgagccaggcggcg
cgtcagaccctctctcttgaaaccgatctctctctgcgcgacgttcaggccctggctgac
gttgtccacgatgcccgcgatatcgccgccagcatctcttcgggctcgtttaaaacggcc
ggcatggttattttgccctgttcgattaaaaccctttccggcattgtaaacagctatacc
gacacgctggtgacgcgtgcagcggatgtggtgctaaaagagcgtcgtcctctggtgctc
tgcgtgcgggaaacgccgctgcacctgggacatctgcgtttaatgacgcaggcagccgaa
ctgggggccgtgattatgccgccggtccccgcgttctatcatcgtccgcaaacgctggac
gatgtcatcaaccagaccgttaaccgcgtactggatcagttcgatatcgacctgccggaa
gatctctttacccgctggcagggggcgtga

DBGET integrated database retrieval system