KEGG   Enterobacter hormaechei CAV1176: AB284_10160Help
Entry
AB284_10160       CDS       T04593                                 

Definition
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00130  Ubiquinone and other terpenoid-quinone biosynthesis
ehm01100  Metabolic pathways
ehm01110  Biosynthesis of secondary metabolites
Module
ehm_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    AB284_10160
Enzymes [BR:ehm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     AB284_10160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 HTH_32 Thioesterase
Motif
Other DBs
NCBI-ProteinID: ANS16985
Position
1911456..1912232
Genome map
AA seq 258 aa AA seqDB search
MILAGFSQPGKPGYPWLVFLHGFSGDCREWQAVGASLHDYPRLYLDLPGHGGSADTGVTG
FAEVSELLSHTLVSYNILRYWLVGYSLGGRIAMFHACQHPAGLDGVIVEGGHPGLQDADA
RQARLIADRRWASRFRSEPLEAVFADWYQQPVFASLTDDQRRALIALRCRNNGPRLAEML
EATSLAVQPDLRPALTARDFSFDYLYGERDGKFAAIAAELNVTRHAIPHAGHNAHRDTPE
AVAASLAQILRYRTKDTL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgatcctcgcaggcttctcccagccaggaaaaccaggctacccctggctggttttcctg
cacggtttttccggcgactgtcgcgagtggcaggctgtcggggcgtcgctgcatgactac
ccccggctctaccttgacctgcccgggcacggtggttcagcggatacgggcgtgacgggg
tttgcagaggtaagtgaattgctctcgcatacccttgttagttacaacatactaagatac
tggctcgtggggtactccctcggcggccgcattgcgatgttccatgcctgccagcatcct
gcggggttagacggggtgattgtggaaggtggacacccgggcctgcaagacgccgatgcg
cgccaggcgcggctgatcgctgaccgccgctgggcgtcacgctttcgcagtgagccgctg
gaggccgtctttgccgactggtatcaacagccggtctttgcctcccttacggatgatcag
cgcagggcgctgatcgcgctgcgctgccggaacaacggcccgaggctggcagagatgctg
gaagccacctcgcttgccgttcagcctgatttacgtcccgcgctcaccgcgcgtgatttt
tcttttgactatctctatggcgaacgtgacgggaagtttgcagccatcgccgctgaactt
aacgtcacgcgtcatgctatccctcacgccggacacaacgctcaccgggacaccccggaa
gctgttgccgcgagtctggctcagatactgcgttatcgaacaaaggacacgctatga

DBGET integrated database retrieval system