KEGG   Enterobacter hormaechei CAV1176: AB284_13785Help
Entry
AB284_13785       CDS       T04593                                 

Gene name
adhP
Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00010  Glycolysis / Gluconeogenesis
ehm00071  Fatty acid degradation
ehm00350  Tyrosine metabolism
ehm00625  Chloroalkane and chloroalkene degradation
ehm00626  Naphthalene degradation
ehm01100  Metabolic pathways
ehm01110  Biosynthesis of secondary metabolites
ehm01120  Microbial metabolism in diverse environments
ehm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB284_13785 (adhP)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB284_13785 (adhP)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AB284_13785 (adhP)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB284_13785 (adhP)
   00626 Naphthalene degradation
    AB284_13785 (adhP)
Enzymes [BR:ehm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AB284_13785 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 DUF2284
Motif
Other DBs
NCBI-ProteinID: ANS17657
UniProt: A0A2J0Q623
Position
complement(2689355..2690365)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVNVTEKTLRALKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEIGPGVTSLKVGDRASVAWFFEGCGHCEYCNTGNETLCRDVKNAGYSVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSDIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLAASMGADLTVNSRSEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLLEAFQFAAEG
KVKPKVTMRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgttgtcactcaggatcatcaggttaatgtcacagaaaaaaccttacgc
gcgctcaaacatggtgaagcgctgctgaagatggagtgctgtggcgtttgccataccgat
ctccatgttaagaatggcgattttggcgacaaaaccggggtgatcctcggccacgaaggg
attggtatcgtcaaagagattggtcctggcgtcacgtcgctaaaagtaggcgatcgtgca
agcgtggcgtggtttttcgaaggctgtggccactgtgaatattgtaataccggcaacgaa
acgctgtgccgtgacgtgaaaaacgcgggttactccgttgacggcggcatggcggaagag
tgcatcgtaaccgcggattacgcggttaaagttccggacggactggactctgcggcggcc
agcagcatcacctgcgccggggtcaccacctacaaagcggtaaaagtctctgacatcaaa
cccggccagtggattgcgatctatggcctgggcggtctgggcaacctcgcgctgcaatac
gccaaaaatgtcttcaatgcgaaggttatcgccattgacgtgaatgacgaacagttgaag
ctcgctgccagcatgggcgcagacttaaccgtgaactcccgcagtgaagatgcggcaaaa
gtgattcaggagaaaaccggcggtgcacatgcggcggtggtgacggcggtagcgaaagcg
gccttcaactctgccgttgacgcagttcgcgccggaggtcgcgtggtggctgtaggcctg
ccgccggaagcgatgagcctggatattccacgtctggtcctggatgggattcaggtagtg
ggttccctggtgggtacccgtcaggatctgctcgaagccttccagtttgcggctgaaggt
aaggtgaaaccgaaagttacaatgcgcccactggaagatatcaacgccatcttcaaagag
atggaacagggccagatccgtggccgtatggtgattgatttacgttcttaa

DBGET integrated database retrieval system