KEGG   Enterobacter hormaechei: AB284_13900Help
Entry
AB284_13900       CDS       T04593                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ehm  Enterobacter hormaechei
Pathway
ehm00052  Galactose metabolism
ehm00500  Starch and sucrose metabolism
ehm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AB284_13900
   00500 Starch and sucrose metabolism
    AB284_13900
Enzymes [BR:ehm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AB284_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 Reg_prop
Motif
Other DBs
NCBI-ProteinID: ANS17679
Position
2713793..2715199
Genome map
AA seq 468 aa AA seqDB search
MTLSSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKIWWHDGLWYMVLGAQDRQ
QRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFELDGTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFAHGELHELDAGFEFYAPQTTVAEDGRRILIGWLGV
PDGEEMLQPTRAHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHLWQGRASDAPVL
AGARLEFELSASSVNVDFAGALRLIVDDEGIRLERASLKTTDTLTRYWQGNVHHLRVLCD
CSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttatcttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacgggtttatctggtttgccgggcgctaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgttgggggcactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgatggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtacaccgggcacgtccgcgat
ccgaaaatatggtggcatgacgggctgtggtacatggtgctcggcgcgcaggatcgacag
cagcgcggcaaggtgctgctgtttacgtcagccgatttacacacctgggcgtcctgcggc
gaaatcgccggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgagcttgatggcacacacgtcttgatctgctgcccgcaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagtggggcatttgattat
caaacgcctgcatttgcgcacggcgagctgcatgagcttgacgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggttgggcgtg
ccggacggcgaagagatgctccagcctacgcgggctcacggctggatccaccagatgacc
tgtcctcgcgagctgcgctaccgcgacggtaagctctggcaaaccccggtccgtgagctg
gaaacgctgcgcgaggatgaacatctctggcagggacgcgccagcgatgccccggtgctg
gcgggagcgcgtcttgagttcgaactgagcgcatcgagcgtgaacgtggattttgccggc
gcgttgcggctgattgtggatgatgaggggatccgtctggaacgcgccagtctgaaaacc
acagacacgctgacccgctactggcagggcaatgttcatcatttacgcgtgctgtgcgac
tgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggtacgcttcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system