KEGG   Enterobacter hormaechei CAV1176: AB284_20205Help
Entry
AB284_20205       CDS       T04593                                 

Definition
(GenBank) ACP phosphodiesterase
  KO
K08682  acyl carrier protein phosphodiesterase [EC:3.1.4.14]
Organism
ehm  Enterobacter hormaechei CAV1176
Pathway
ehm00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:ehm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AB284_20205
Enzymes [BR:ehm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.14  [acyl-carrier-protein] phosphodiesterase
     AB284_20205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_PD
Motif
Other DBs
NCBI-ProteinID: ANS18847
Position
4032288..4032869
Genome map
AA seq 193 aa AA seqDB search
MNFLAHLHLAHLADSSLSGNLLADFVRGNPAEAYSPEVVDGIFMHRRIDVLTDNLPEVTE
AKAWFRPETRRVAPITLDVMWDHFLSRHWSRLSPDMSLPEFVRYAHAQVSIILPDSPPRF
VNLNNYLWSERWLERYREMDFIQNVLNGMASRRPRLDALRDSWHDLDEHYDALETRFWQF
YPRMMTQAKNKEL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctcgctcatctgcatctcgctcatctcgcggacagctccctctccggcaat
ttgctggccgattttgtacgcggcaaccccgcggaagcgtactcccctgaggttgtcgac
gggatttttatgcaccgccgcatcgacgtgctgaccgataacctgccggaagtgacggaa
gccaaagcctggttccgccccgaaacccgacgcgtggcgccgatcacgctcgacgtcatg
tgggatcatttcctgtcgcgccactggtcccggctgtcgcctgatatgtcgctgcctgag
tttgtgcgctacgcccacgcgcaggtgtcgatcattttgccggactccccgccgcgcttt
gtgaatctgaataactatctctggtctgaacgctggctggagcgataccgcgagatggat
ttcattcagaacgtcctgaacggcatggcgagccgtcgaccgcgtctggacgcgctgcgc
gactcatggcatgacctggatgaacattatgatgcgctggaaacccgcttctggcagttc
tacccgcgtatgatgacgcaggcgaaaaataaagaactgtga

DBGET integrated database retrieval system