KEGG   Edwardsiella hoshinae: A9798_05950Help
Entry
A9798_05950       CDS       T04508                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00260  Glycine, serine and threonine metabolism
eho01100  Metabolic pathways
eho01110  Biosynthesis of secondary metabolites
eho01120  Microbial metabolism in diverse environments
eho01130  Biosynthesis of antibiotics
eho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A9798_05950
Enzymes [BR:eho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A9798_05950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AOV96537
UniProt: A0A376DC94
Position
complement(1335130..1336182)
Genome map
AA seq 350 aa AA seqDB search
MLDLRSDTVTRPSEAMRLAMSRADVGDDVYGDDPSVNRLEQEAAELSGKQAALFLPSGTQ
ANLVALLTHCQRGDEYIVGQKAHNYMYEAGGAAVLGSIQPQPIDAAEDGTLPLPQVASVI
KPDDIHFARTRLLSLENTHNGKVLPLTYLAQAWAFSREKRLALHIDGARIMNAAVALAVP
LTTLTQYCDTLTLCLSKGLGAPVGSLLCADADFIRQARRWRKMTGGAMRQAGILAAAGRY
ALQHNVERLRDDHANAAWLAQAVQELGLELLPPGAQTNMLFVRMSADEAAALGPWMQRHG
ILISAGAITRLVTHLDVSRADLERLVALWRTFRQEYRPASGSAPAPTPYG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatctacgtagcgataccgtaacccgtcccagcgaagccatgcgcttggccatg
tcacgcgccgacgtcggcgatgacgtctatggcgacgatcccagcgtcaaccgtctggag
caagaagcagccgaattaagcggcaagcaagcggcgctgtttctgcccagcggcacccag
gccaacctggtggcactgctgacccattgccagcgcggcgacgagtatatcgtcgggcag
aaggctcataactacatgtatgaggcgggcggcgcggcggtgctcggcagcattcaaccg
caacctatcgatgccgccgaggatggcaccctccccttgccgcaggtggcgagcgtgatc
aaacccgacgacatccacttcgcccgcacccgactgctcagcctagagaatactcataac
ggcaaggtgttaccgctgacctatctggcgcaagcctgggcattcagccgcgagaagcga
ctggcgctacacatcgacggagcccgtatcatgaatgcggcggtggcgctggcggtaccg
ctcactaccctgacgcagtactgcgacaccctgaccctctgcctgtccaagggactcgga
gcaccggtcggctcactgttgtgcgccgatgcggacttcattcgccaagcgcgccgctgg
cgtaaaatgaccggtggtgccatgcgtcaggcggggatcctggccgcagcgggacgctac
gccttgcagcacaacgtcgaacgcctacgcgatgaccacgccaacgccgcatggctggcc
caggccgtgcaagagctagggttggaactcctgccgcccggcgcccagactaacatgctg
ttcgtgcgtatgtccgccgatgaagccgccgcgctgggcccctggatgcagcgccacggt
atcctgatcagcgcgggcgctatcacccgcctggtcacccacctcgatgtcagtcgggcc
gatctggagcggttggtcgccctgtggcgtactttccgccaggagtatcgtccagcgagc
ggttcggcgccggctcccacgccctacggctaa

DBGET integrated database retrieval system