KEGG   Edwardsiella hoshinae: A9798_08135Help
Entry
A9798_08135       CDS       T04508                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00670  One carbon pool by folate
eho01100  Metabolic pathways
eho01120  Microbial metabolism in diverse environments
eho01200  Carbon metabolism
Module
eho_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    A9798_08135
Enzymes [BR:eho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     A9798_08135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AOV96931
Position
complement(1843453..1845183)
Genome map
AA seq 576 aa AA seqDB search
MTSRCETMPTCQPALQPIAAIAKRIGISPEALIPYGPYAAKVDLRRITNRAPRGKLILVS
SITPTPLGEGKTVTTLGLSQGLNYLGHPAIACIRQPSLGPVFGVKGGAAGGGASQVLPME
QLNLHLTGDIHAISAAHNLAAAALDARLFHEQRLGDEFTAQSGLPRLDIDPQRIVWKRVM
DHNDRALRSIEVGVGGGNNGVTRHDGFDISAASELMAILALSEGLADMRTRIGKVILAYS
TQGQAITADDLQVAGAMTVVMKEAIHPTLMQSSEQTPVLIHAGPFANIAHGNSSVLADRL
ALQLADYVVTEAGFGSDMGMEKFFNIKYRQSGIAPSCVVLVATLRSLKANSGRFNMKPGQ
PLPEAVKQPDADLLRLGCENLGWHIANARRYGLPVVIAVNRWPEDTAQELAILRDYALSA
GAFGVEFSEAFARGGEGAARLAACVTDACSQAGQVTLLYPDDLPLADKLQTLARSYGARQ
VELTQQAQQELAALEQAGFGHLPLCMAKTPLSISADPALKNVPHDFTLPVRSLQVSAGAG
FIRVYAGNIMTMPGLSTRPAYLHIDIDHDGNTVGLS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcgctgcgaaacgatgcccacctgccaacccgcgttgcagccgatcgccgcc
atcgctaagcggataggcatctctccggaagcactgatcccttatggcccctatgcggcc
aaagtcgatctgcgccgcatcactaaccgcgcaccgcgcggcaagctgatcctcgtctcc
agtattaccccgacgcccttaggtgaaggcaaaaccgtcactaccctcggactaagccaa
gggcttaactacctgggccatcccgccatcgcttgcatccgtcagcccagcctggggccg
gtcttcggcgtcaaaggcggagcggccggcggcggagcctcgcaggtgctgccgatggag
cagctcaacctgcatcttaccggtgatatccatgccatcagcgcggcccataacctagcc
gccgccgccctcgatgcgcgcctcttccacgaacaacggctcggcgacgaattcacggcc
cagagtgggctgcctcgtctggatatcgatccgcaacgcatcgtctggaagcgcgtcatg
gatcataacgatcgtgcgttgcgtagcatcgaggtcggtgtcggtggcggcaacaacggg
gtaacgcgccacgatggctttgacatcagtgccgcctcggagctaatggccattctagcc
ctttccgaaggcctggctgacatgcggacgcgtatcggcaaggtgatcttggcctattcg
acgcaagggcaagcgatcaccgccgacgatttgcaggtcgccggggccatgaccgtggtg
atgaaagaggccatccaccctaccctgatgcagagcagcgaacagacaccggtactgatc
catgccggaccgttcgccaacatcgcccacggtaattcgtcggttttagctgatcgcctg
gcgttacaattggccgactatgtcgtcaccgaggcaggcttcggctccgacatggggatg
gagaagtttttcaatatcaaatatcgccagtcagggatcgccccgtcttgcgtggtactg
gtcgcgaccctgcgcagcctgaaagctaatagcgggcgtttcaatatgaaaccgggccag
ccattaccggaagcggtgaagcaaccggatgccgatctgctgcgcctcggttgtgaaaat
ctgggctggcatatcgccaacgcccgtcgctacggcttgccggtagtgatcgccgtcaac
cgctggccggaggataccgcacaggaattagccatcctgcgcgactatgcgctcagtgcc
ggcgccttcggggttgagttcagcgaggccttcgctcgcggtggcgagggcgccgcccgt
ctggccgcctgtgtcaccgatgcctgtagtcaagcggggcaagtgacactgctctacccg
gatgatctgccgctggccgacaagttgcagaccctggcccgcagctacggcgcccgccaa
gttgaactcacccaacaggcgcagcaggagttggcggcgctggagcaggcgggcttcggc
cacttaccgctgtgcatggccaagacgccgctatcgatcagtgccgatccggcgttgaaa
aacgttccgcacgactttacgctgccggtgcgtagtctacaggtctccgccggtgcgggc
tttattcgcgtctatgccggtaatatcatgaccatgccgggactcagcacgcggccagcc
tatctccatatcgatatcgatcacgacggcaataccgtcggcctcagctaa

DBGET integrated database retrieval system