KEGG   Edwardsiella hoshinae: A9798_13535
Entry
A9798_13535       CDS       T04508                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eho  Edwardsiella hoshinae
Pathway
eho00230  Purine metabolism
eho01100  Metabolic pathways
eho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9798_13535
Enzymes [BR:eho01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     A9798_13535
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AOV97867
UniProt: A0A376DKS2
Position
3062621..3064912
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGKVTAIDTREAAAMPGV
EAIFTCYDVPQTPFPTAGHAWSLDPAKHDVADRHLLTDHVRHFGDGVAIVVARDLLSAER
AAARVQVSYEALPVLTRPQAALAEGAPALHPNGNLLRHSEIDAGEPDARIAAAERQFAGH
YETPVVQHCHMEGVTCYAYMEQPGHVVIVSSTQIPQIVRRTVAQALSLPWSHVRVIKPYI
GGGFGNKQDVLEEPMAAFLTLRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMQRDGQ
LLGYRLNVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAVSLGLDPLEVRLRNVARQGDRNPVNGKTIYSAGLSECLEKGRTL
FEWDQRRAACLAQDADARLRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAETLGIPFTQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRQAA
EQLRQKILAHAALLSHQPEWGLTLRDGNVVMAMQPEQVLMSVADVSMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSVDIDLCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEHSGVVRNPNLLDYKFPTCVDLPDLECAFVETYEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPLTPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcaccgctacggcgggttgatgccgaagccaaggtcaccggacaggca
cgttataccgatgatatgatgatgcccggcatgctccacgcctgttatgttcgcagccgc
atcgcccacggcaaggttactgccatcgatacccgcgaggccgctgcgatgccgggtgtc
gaggccatcttcacctgttatgacgtcccgcagacgccctttcccaccgccgggcacgcc
tggtctctggatcccgcgaaacacgacgtcgccgatcgtcatctgcttaccgaccatgta
cgccacttcggcgacggtgtcgctatcgtggtggcacgcgatctgttgagcgccgagcgc
gccgcggcacgggtgcaggtcagctatgaagcgttgccggtactgacgcggccacaagcc
gccttagccgagggggcgcctgcgctccatcctaacggaaatctgttgcgtcacagcgag
atcgacgccggcgagccggatgcgcgtatcgccgccgccgagcggcaattcgcggggcat
tacgagactccggtggtgcagcactgccatatggaaggcgtcacttgctatgcctacatg
gagcaacccggccatgtggtcatcgtatccagtacccagatcccccagatcgtgcgtcgt
accgtcgctcaggccctcagcttgccctggtcacatgttcgcgtgatcaaaccctacatc
ggtggtggcttcggtaataagcaggatgtattggaggagccgatggcggccttcctgacg
ctacgccttggtggtaagccggtgaaagtcagcctgagccgcgaagagtgctttgtcgct
acgcgcactcgccacgccttcagtatcgatgcacgtttaggcatgcagcgcgatgggcaa
ttgctgggctaccggctgaatgtcttgtccaataccggcgcctatgcctcgcatgggcac
tccatcgccgccgccggggccaataagatcagctacctctacccacgcagtgctttcggt
tattgcgccgacacggtatacaccaaccttcccgccgccggggcgatgcggggctatggc
gcgccacaggtcgatttcgccctggagtgcctgatggatgatgctgccgtcagcctggga
ttagatccgctagaggtgcgtctacgtaacgtcgcccgccaaggcgatcgcaaccccgtc
aacggtaagaccatctacagcgccggtctgagcgaatgtcttgagaaaggacgtaccctg
ttcgaatgggatcagcgccgagccgcttgcctggcccaagatgcggatgcacgcctgcgg
cgcggtatcggtgtcgcctgtttcagttatggctccaatacctatccggtcggtgttgag
atcgctggcgcgcgcatgctgctcaatcaggacggtacggtgaacttgcagatcggcgcc
accgaaatcggccaaggttccgacacagtcttcgcccagatggcggcggaaaccctgggg
atcccgtttacacagatccgggtcatctcgacacaagacaccgatatcaccgccttcgat
cccggggctttcgcctcacggcagagttatgtcgcggcccccgctatccgccaggcagcc
gagcagctacgtcagaagatcctggcgcacgccgcgttactcagtcaccagcccgagtgg
ggactgactctgcgtgatggcaatgtggtcatggcgatgcaaccagaacaggtgttgatg
agtgtcgccgacgtgtcgatgcaggcctactatcaccaggagatcggcgcacagatcctg
gcggaggtctctcataagaccaccaccaacccgccagccttcggctgcactttcgtcgat
ctcagtgtcgacatcgatctgtgtcaggtcaccatcaaccgtatcctgaacctgcatgac
tccgggcgtattctcaacccgcaactggccgagggacaggttcatggcggcatgggcatg
gggatcggttgggcgttattcgaagagatgatcatcgacgaacacagtggcgtcgtccgc
aaccccaatctgctcgattacaagttccccacctgcgtcgatctgccggatctggagtgt
gccttcgtcgagacctacgagccgcagtcggcctatggtcataaggcgttgggtgagccc
ccgatcatctcgccgggaccggctatccgtaacgcgatccgcatggcgaccggcgtcgcg
atcaacgcactgccgctcaccccgaaaacgctgtatcgcgagtttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system