KEGG   Edwardsiella hoshinae: A9798_13545
Entry
A9798_13545       CDS       T04508                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eho  Edwardsiella hoshinae
Pathway
eho00230  Purine metabolism
eho01100  Metabolic pathways
eho01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eho00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9798_13545
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AOV97869
UniProt: A0A376DMK5
Position
3065794..3066288
AA seq 164 aa
MNVKEWVEISCQINGKRYQFCVSPAMSLLELLREHGLTSVKQGCCVGECGACSVLIDGIA
TDSCLYLALWADGKQIVTAEGLGKPQGLSPVQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHEEIRRGLSGNLCRCTGYQAIVRAVDACQRATDDSSS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagaatgggttgaaatcagttgtcagatcaacggtaaacgctatcagttc
tgcgtctcgccggccatgtcccttctggaactgctgcgtgagcatggcctgaccagcgtc
aaacaaggctgctgtgtcggcgaatgtggtgcctgtagcgtcctgatcgatggcatagcg
accgatagctgcctctatctggcgttgtgggccgacggcaaacagatcgtcaccgccgag
gggctgggcaagccacaggggctatcgccggtacagcaagcctatgtcgatgccggcgcg
gttcaatgcggtttctgcacccccggcttagtggtggcaacccatgcgctattggccaag
ccgcgtagccgcccgctgacccatgaggagatccgccgcggtctatccggtaacctatgc
cgttgcaccggctatcaggccatcgtacgtgccgtcgatgcctgccagcgggcgacggac
gactcttcgtcttaa

DBGET integrated database retrieval system