KEGG   Enterococcus hirae: EHR_07320Help
Entry
EHR_07320         CDS       T02160                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
ehr  Enterococcus hirae
Pathway
ehr00740  Riboflavin metabolism
ehr00790  Folate biosynthesis
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
Module
ehr_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    EHR_07320
   00790 Folate biosynthesis
    EHR_07320
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     EHR_07320
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     EHR_07320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AFM70400
UniProt: I6S147
Position
1450777..1451973
Genome map
AA seq 398 aa AA seqDB search
MRNITEAIKTLKKGGLIIVADDEDRESEGDLVGLAEYVTPEAVNFMTKFGRGLICVPISN
DIAQRLSLGEMTTHNTDAFGTAFTISVDHKHTKTGISVFDRATSIKALADPHSKTSDFLR
PGHIFPLISVDGGTLIRRGHTEAAIDLAKLANSVEAAYICEILKEDGTMARMKDLTRLSE
EWQLPLITIDELVNYLEENSHITVNLPTDYGDFKLTIYEDGEKREHLLLTKGDIQNSQFP
TLVRVHSECLTGDVFGSQRCDCGEQLHEAMRMIEEEGTGAILYLRQEGRGIGLRNKLKAY
QLQEKGLDTYEANTELGFAPDERDYHFAAEILKSIGVTSIRLLTNNPDKVIELQQDGITI
VDRVPIETVPKKENQAYLKTKKISFTITYQYKNKGARK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatattactgaagcaataaagaccttgaaaaagggcggattaatcattgtagct
gatgatgaagatagagaatcagaaggagatttggttggtttagccgaatatgtgacacct
gaggcagtaaatttcatgaccaaatttggtcgaggattaatctgtgtgccgatttctaat
gacattgcgcaacgcttatctttaggagaaatgacaactcataatactgatgcgtttggt
acagcttttacgattagtgtggatcataaacatacgaagactggtatttcagtatttgat
cgagctacttccattaaagcattggctgatcctcattcgaaaacaagtgattttcttaga
ccaggacatatttttcctttgattagtgtagatggcggaacgcttatacgtcgaggacac
accgaagctgcaattgatttagccaaattagctaatagtgtagaggctgcttatatttgt
gagattctgaaagaagatggaacgatggcaagaatgaaagatctgacccgtttatctgaa
gaatggcaattacccttaattacgattgatgagttggtaaattatttagaagaaaatagt
catataaccgtaaatttaccaacagattatggtgatttcaaattgactatttatgaagac
ggagaaaaacgggagcatctattgttaacaaagggagatattcaaaatagtcagtttcct
acattagtccgagttcattcggaatgtctaactggtgatgtcttcgggtctcagcgttgc
gattgtggggaacagttacatgaagcgatgagaatgatcgaggaagaggggactggagct
attctttatcttcgtcaagaaggtcgcggaatcggattgaggaataagttaaaagcgtat
caattgcaggaaaaaggattggatacttatgaagcaaatactgaattgggctttgctccg
gatgaacgggattatcactttgcagcagaaattttaaaatcaattggtgtaacgtccatt
cgtttacttacaaacaatcccgataaagtaatagagttacaacaagatggaattacgatt
gtcgatagggtaccaattgaaactgttccgaaaaaggaaaaccaagcctatttaaaaaca
aaaaagataagtttcaccattacttatcagtataaaaataaaggagcaagaaaatga

DBGET integrated database retrieval system