KEGG   Enterococcus hirae: EHR_07600Help
Entry
EHR_07600         CDS       T02160                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ehr  Enterococcus hirae
Pathway
ehr00627  Aminobenzoate degradation
ehr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    EHR_07600
Enzymes [BR:ehr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     EHR_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 HTH_32
Motif
Other DBs
NCBI-ProteinID: AFM70456
UniProt: I6T6S7
Position
1508027..1508791
Genome map
AA seq 254 aa AA seqDB search
MDYKGYLIDLDGTIYRGTEPIPAGKRFVEALQAKKQPFLFVTNNTTKSPQAVANRLADEF
DIHVSPETVYTASLATIDFMHAAGKGNTFYAIGEAGLIDLILEAGFVWDEENPDYVVVGL
DNYLTYEKVVKATLAIQKGATFIGTNPDKNIPTERGLLPGAGSVISFVETATQTPPIYIG
KPEAIIMDKAVEKLGLTKADVIMVGDNYETDIQAGIRNGIDTLLVLSGFTKAEDVPLLPV
PATHVLRSLDEWSF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggattataaaggatatttgattgatttagatggaacgatttatcgggggactgaacct
atacctgctgggaaacgttttgtggaggctcttcaggcaaaaaaacagccttttctgttt
gttacgaataacaccacaaaaagtccacaagcagtagcaaatcgcttggcagatgaattt
gatatacacgttagccctgaaactgtttatacagcttctttagcaacgatcgattttatg
cacgctgccgggaaaggaaacacgttttatgccataggtgaagctggtttgatcgatttg
attttagaagcaggatttgtctgggacgaagaaaatcccgattatgtagtagtcggtcta
gataattatctgacgtatgaaaaagtagtcaaagcgactcttgcaatccaaaaaggggca
acatttattggaacaaatccagataaaaatattccaactgagcgtgggttgctgccgggt
gcaggatcggtaatttcgtttgtggagacagctacgcagacgccaccgatttatattggc
aaaccagaagcgatcattatggataaggcggtagaaaaattaggtttaacgaaagcagat
gtcatcatggttggagacaactatgaaacagacatccaagcagggattcgaaatgggatt
gatacgttgttggtgctctcaggatttacgaaagctgaggatgtacctttattaccggta
cctgctacacacgttctccgttcgttagatgagtggagtttctag

DBGET integrated database retrieval system