KEGG   Enterococcus hirae: EHR_08400Help
Entry
EHR_08400         CDS       T02160                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ehr  Enterococcus hirae
Pathway
ehr00010  Glycolysis / Gluconeogenesis
ehr00051  Fructose and mannose metabolism
ehr00562  Inositol phosphate metabolism
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01120  Microbial metabolism in diverse environments
ehr01130  Biosynthesis of antibiotics
ehr01200  Carbon metabolism
ehr01230  Biosynthesis of amino acids
Module
ehr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ehr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_08400 (tpiA)
   00051 Fructose and mannose metabolism
    EHR_08400 (tpiA)
   00562 Inositol phosphate metabolism
    EHR_08400 (tpiA)
Enzymes [BR:ehr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EHR_08400 (tpiA)
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EHR_08400 (tpiA)
  Exosomal proteins of bladder cancer cells
   EHR_08400 (tpiA)
  Exosomal proteins of melanoma cells
   EHR_08400 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFM70607
UniProt: I6SYS7
Position
1663795..1664550
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTASEAKEFAEAVKNNIPSNEKVDSVIGSPALFLQELMASAEGTELK
ISAQNCYWENSGAFTGETSPAALADLGVDYVIIGHSERREYFHETDEDINKKAKAIFANG
MIPILCCGESLETYEAGKTAEWIEGQITAGLEGLTDGQVSNMVIAYEPIWAIGTGKSADA
QIADEICGVVRQTVEKLYGKEVSDAVRIQYGGSVKPENIAEYMAKENVDGALVGGASLQA
DSFLALLDAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgctggtaactggaaaatgaacaaaactgcatctgaagcaaaa
gaatttgctgaagcagtaaaaaacaacatcccttcaaatgaaaaagttgattctgttatc
ggatcacctgctttgttcttacaagaactaatggcttcagctgaaggaacagaattaaaa
atctcagcacaaaactgctactgggaaaactcaggtgcattcacaggtgaaacttcacca
gctgctttagcagacttaggtgtggactatgtgatcatcggacattcagaacgtcgtgaa
tacttccatgaaacagatgaagacatcaacaaaaaagcgaaagctatctttgcaaacggc
atgatcccaattctttgctgtggtgaatctttagaaacttacgaagctggaaaaacagct
gaatggatcgaaggacaaatcactgctggtcttgaaggattgacagatggccaagtaagc
aacatggttattgcttacgaaccaatttgggcaatcggtactggtaaatcagctgatgca
caaattgctgacgaaatctgtggcgttgtacgtcaaacagttgaaaaattatacggcaag
gaagtatctgatgcagtacgtatccaatacggtggttctgtaaaaccagaaaacattgct
gaatatatggcgaaagaaaatgttgacggagcattagttggtggcgcaagcttacaagct
gattcattcttagcattattagacgctgtaaaataa

DBGET integrated database retrieval system