KEGG   Enterococcus hirae: EHR_10995Help
Entry
EHR_10995         CDS       T02160                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ehr  Enterococcus hirae
Pathway
ehr00010  Glycolysis / Gluconeogenesis
ehr00260  Glycine, serine and threonine metabolism
ehr00680  Methane metabolism
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01120  Microbial metabolism in diverse environments
ehr01130  Biosynthesis of antibiotics
ehr01200  Carbon metabolism
ehr01230  Biosynthesis of amino acids
Module
ehr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ehr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHR_10995 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EHR_10995 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EHR_10995 (gpmA)
Enzymes [BR:ehr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EHR_10995 (gpmA)
Membrane trafficking [BR:ehr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EHR_10995 (gpmA)
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EHR_10995 (gpmA)
  Exosomal proteins of melanoma cells
   EHR_10995 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFM71084
UniProt: I6TCF4
Position
2150741..2151409
Genome map
AA seq 222 aa AA seqDB search
MKLVLLRHGESEANFQNYWTGWLDVALTEKGMQQATEAGRKMNEQGLVFDIVYTSVLKRA
IKTSQLALEEMNQLYLPVQKTWRLNERHYGALVGKNKTEMKKEYGEEQVKKWRRGYREVP
PLVSENHFDRRYDSLDPRLLSHGESLEMTVERVVPLWQDELAPHLLGGKNVLVVGHGNSL
RALTKYLEDVPENQLDTIDIPNAQPIQYTLNKELEILGKELL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtcttattacgacatggtgaaagtgaagccaattttcaaaattattggact
ggctggttagatgttgcgctaactgaaaaggggatgcaacaagcaacggaagctggacga
aaaatgaatgagcaaggattggtttttgatatcgtttatacatctgtactaaaaagagca
atcaaaacgtcacagttagctttagaagaaatgaatcaattgtatcttcccgtccaaaaa
acttggcggttaaatgaacgacattatggggcattagttggtaaaaataaaacggagatg
aaaaaagaatatggcgaagaacaagtcaaaaaatggcgtcgtggctatcgagaagttccg
ccactcgtatcagaaaaccattttgatcgacgctatgattctttagatccacgtttgctc
tcccatggtgaaagcttagagatgacagttgagcgcgtggttcctttatggcaagatgaa
cttgcaccacacttattaggtggtaaaaatgtcttagtggttggacatgggaatagctta
cgtgcgttaacgaaatacttagaagatgtaccagaaaatcagttggatacgattgatatc
ccgaatgcgcaaccgattcaatacactttaaataaagagttagaaatcctcggaaaagaa
ttgttataa

DBGET integrated database retrieval system