KEGG   Enterococcus hirae: EHR_13745Help
Entry
EHR_13745         CDS       T02160                                 

Definition
(GenBank) acetyl-CoA acetyltransferase/hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ehr  Enterococcus hirae
Pathway
ehr00071  Fatty acid degradation
ehr00072  Synthesis and degradation of ketone bodies
ehr00280  Valine, leucine and isoleucine degradation
ehr00310  Lysine degradation
ehr00362  Benzoate degradation
ehr00380  Tryptophan metabolism
ehr00620  Pyruvate metabolism
ehr00630  Glyoxylate and dicarboxylate metabolism
ehr00640  Propanoate metabolism
ehr00650  Butanoate metabolism
ehr00900  Terpenoid backbone biosynthesis
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01120  Microbial metabolism in diverse environments
ehr01130  Biosynthesis of antibiotics
ehr01200  Carbon metabolism
ehr01212  Fatty acid metabolism
ehr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EHR_13745
   00630 Glyoxylate and dicarboxylate metabolism
    EHR_13745
   00640 Propanoate metabolism
    EHR_13745
   00650 Butanoate metabolism
    EHR_13745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EHR_13745
   00072 Synthesis and degradation of ketone bodies
    EHR_13745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EHR_13745
   00310 Lysine degradation
    EHR_13745
   00380 Tryptophan metabolism
    EHR_13745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EHR_13745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EHR_13745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EHR_13745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ehr04147]
    EHR_13745
Enzymes [BR:ehr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EHR_13745
Exosome [BR:ehr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EHR_13745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AFM71603
UniProt: I6SG32
Position
complement(2684118..2685326)
Genome map
AA seq 402 aa AA seqDB search
MKEVVIIDAARTPIGKYRGSLSSFSAVELGTIITKELLEKTGIHKENINQVIFGNVLQAG
NGQNVARQISVNSGIPVQVPAMTVNEVCGSGMKAVILARQLIQLGEADLVVAGGTESMSR
APLLQQYEAENATYEEPISSMVNDGLTDAFSNAHMGLTAEKVANEFSVTRTEQDQYALNS
QKKAAQASENGVFEAEIIPVTLPDQRIMDKDEAIRGNSTLEKLGTLKTVFSENGTVTAGN
ASPLNDGASVLILASKEYAIKHGLPYLATIKAVSEIGIDPSIMGIAPISAIQTLLKKAEI
SIDQIDRFEINEAFAASSIVVNRNLKLAEEKVNVDGGAIALGHPIGASGARILTTLSYGL
KRMNQQYGVASLCIGGGLGLAMLLEANLETEQSSDQKKSFIN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaagtcgttattatagatgctgcgagaacgccaattggaaagtatcgtggcagt
ttaagcagtttttctgctgtagaattaggaacaatcattacaaaagaactgttagaaaaa
acaggtatccataaagaaaacatcaatcaagtaatatttggaaatgtattacaagcgggg
aatggtcagaatgttgccagacaaatttctgtcaatagtgggatccctgttcaggttcct
gccatgacagtcaacgaagtatgtggctcaggaatgaaggcggttattttggctcgccaa
ttgattcagttaggtgaagctgatctagtagtcgcaggaggcactgaaagcatgtcacgt
gcgccactgcttcagcaatatgaagcagaaaatgcaacttatgaagagccgatctcaagt
atggtcaatgatgggctgacagatgcgttctcaaatgcacatatgggcttaactgctgaa
aaagtagcgaacgaattttccgttacgagaacagaacaagatcaatatgcgctcaactca
caaaaaaaagcagctcaagctagtgaaaacggggtatttgaagcagaaattattcccgtt
actttacctgatcaaagaatcatggataaagacgaagccatccgagggaatagtacactg
gaaaaattagggactttgaaaactgttttttccgaaaatgggactgtgacagcagggaat
gcttctccgttaaatgatggagcatcggtattgattttagcttcaaaagaatatgcgatc
aaacatgggcttccttatcttgcaacgatcaaggctgtttctgaaattgggattgatccg
agcattatgggaattgcacctatctcagcaatccaaacattattgaaaaaagcagaaatt
tctattgatcaaatcgatcgttttgagatcaacgaagcatttgcggcttcatcgatcgtg
gtcaatcgcaacttaaaactagctgaagaaaaagtcaatgtagatggtggtgccatcgca
ctcggtcatccgattggtgcaagtggtgctcgtattttgacaacattaagttatggcttg
aaacgaatgaaccaacaatatggtgtggcttctttatgtattggtggaggcttaggacta
gccatgttacttgaagcaaatctagaaacggaacaatcaagtgaccaaaaaaaaagtttt
atcaactga

DBGET integrated database retrieval system