KEGG   Enterococcus hirae: EHR_13750Help
Entry
EHR_13750         CDS       T02160                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ehr  Enterococcus hirae
Pathway
ehr00072  Synthesis and degradation of ketone bodies
ehr00280  Valine, leucine and isoleucine degradation
ehr00650  Butanoate metabolism
ehr00900  Terpenoid backbone biosynthesis
ehr01100  Metabolic pathways
ehr01110  Biosynthesis of secondary metabolites
ehr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ehr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EHR_13750
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    EHR_13750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EHR_13750
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EHR_13750
Enzymes [BR:ehr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     EHR_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III Chal_sti_synt_N ACP_syn_III_C mIF3
Motif
Other DBs
NCBI-ProteinID: AFM71604
UniProt: I6TDP4
Position
2685512..2686663
Genome map
AA seq 383 aa AA seqDB search
MKVGIDRLSFFIPNLYLDMTELAERRGDDPAKYHIGIGQDQMAINRVSEDIVTLGANAAT
RIVTNEDRELIDMVIVGTESGIDHSKASAVIIHHLLKVQPFARSFEVKEACYGGTAALHM
AKEYVKNHPDRKVLVIASDIARYGLASGGEVTQGVGAVAMMVTKDPRIITIEDDSTFLTE
DIYDFWRPDYAQYPVVDGPLSNSTYIESFQKVWNRHKEVTGFTLEDYDALSFHIPYTKMG
KKALQSVLDQTDEKTQNRLLTRYEESIRYSRRIGNLYTGSLYLGLISLLENSQVLKSGDR
IGLFSYGSGAVSEFFTGYLQDGYQDFLLTELHQEMLEGREAVTVDQYETIFKEKLPEHGE
TAEYSSDVPFSIYKVENDIRYYK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagggattgatcgtctttccttttttattccaaatttatatttagatatgaca
gagttagctgaacgtcggggagatgatcctgctaaataccatatcggtattggccaagat
caaatggccatcaaccgagtgtcagaagatatcgtgactttaggagcaaatgcagctact
aggatcgtcacaaatgaagatcgcgagctgatcgatatggttatcgtaggaacggaatct
ggcatcgatcattcaaaggcgagtgctgtaattatccatcatttattgaaagtccaacct
tttgctcgttcgtttgaagtaaaagaagcttgttatggtggaactgctgctctccacatg
gcaaaagaatatgtaaaaaatcatccagatcgaaaagttttagtgatcgctagtgacatc
gcccgttatggtctagctagtggtggagaagtgacacaaggtgtgggtgctgtcgctatg
atggttaccaaagatccacgaatcatcactatcgaagacgatagtactttcttaaccgaa
gatatttatgatttttggcgtcctgattatgcgcaatacccagtggttgatggtccttta
tccaactccacttatatcgaatcttttcaaaaagtttggaatcgacataaagaggtaaca
ggatttactttagaagactatgatgcgctaagttttcacattccttacacaaaaatgggg
aaaaaagccttacaaagtgtcttggatcagacagatgaaaaaacacaaaatcgcttattg
actcgctatgaagaaagtattcgttatagtcggcgaattggtaacctttatactggttct
ctttatctaggattgatttctcttttagaaaactcacaagtgttaaaatcaggtgatcga
attggcttattcagctatggttcgggtgctgtcagtgaatttttcacaggttacttacaa
gacggctatcaagatttcctattgactgaactacatcaagaaatgttagaaggtagagaa
gctgtcacagtcgatcaatatgaaacaatcttcaaggaaaaattacctgaacatggggaa
acagccgaatattcttccgatgtaccattttcaatctataaagttgaaaatgatattcgt
tactacaagtaa

DBGET integrated database retrieval system