KEGG   Emiliania huxleyi: EMIHUDRAFT_108359Help
Entry
EMIHUDRAFT_108359 CDS       T02915                                 

Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ehx  Emiliania huxleyi
Pathway
ehx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EMIHUDRAFT_108359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ehx03011]
    EMIHUDRAFT_108359
Ribosome [BR:ehx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EMIHUDRAFT_108359
  Bacteria
    EMIHUDRAFT_108359
  Archaea
    EMIHUDRAFT_108359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 17285952
NCBI-ProteinID: XP_005793111
JGI: Emihu1_108359
UniProt: R1DZW4
Position
Unknown
AA seq 196 aa AA seqDB search
MLARLAGSSRGPAARAVRSLSSALGVPLPVAPAAEVKPGRTAQAFYRNLPVSPKKLRVVA
NLTPKLYWREAMMQLEFCRKQMAVMVKNAIESAAGNAEAQGLSKERLVVDEVVVNKGKHF
KKMDIKARGKTGIRKTYFSHLRVVLREVAEEEVGRTQHFGKWRPGSKLNQLLALPWAERV
KHLPRYKPLPGYDPHG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgactcgctggaagctctcgaggccccgccgcgcgggcggtccggtccctg
tcgtcggcgctcggcgtcccgctgcccgtcgctccggctgccgaggtcaagcctggccgc
acggcgcaggcattctaccgcaacctgcccgtctcgccgaagaagctgcgcgtggtggcg
aacctcactcccaagctgtactggcgggaggcgatgatgcagctcgagttttgccgcaag
cagatggccgtcatggtcaagaatgcgatcgagtcggccgccggcaacgccgaggcgcag
ggcctctccaaagaaagattagtcgtggacgaggttgtcgtcaacaaggggaagcacttc
aaaaagatggacatcaaggcgagggggaagacggggatccgcaagacgtacttttcgcac
ctgcgcgtggtcctccgcgaggttgccgaggaggaggtcggccgcacgcagcactttgga
aagtggcggcccggctcgaagctaaaccagctgctcgcgctgccgtgggcggagcgagtc
aagcacctcccgcgatataagcccctcccaggctacgacccgcacgggtga

DBGET integrated database retrieval system