KEGG   Emiliania huxleyi: EMIHUDRAFT_197348Help
Entry
EMIHUDRAFT_197348 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00480  Glutathione metabolism
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EMIHUDRAFT_197348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ehx02000]
    EMIHUDRAFT_197348
Enzymes [BR:ehx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EMIHUDRAFT_197348
Transporters [BR:ehx02000]
 Other transporters
  Pores ion channels [TC:1]
   EMIHUDRAFT_197348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_2 TPR_16 GST_C_6 TPR_2 TPR_1 TPR_7
Motif
Other DBs
NCBI-GeneID: 17261068
NCBI-ProteinID: XP_005767213
JGI: Emihu1_197348
UniProt: R1E1F2
Position
Unknown
AA seq 209 aa AA seqDB search
MSIASKPVVLGYWAIRGLAQPIRMLLEYSSIPYEEKRFEQGGAPDFDKTCWTDVKDTVLG
DYPFPNLPFLIDGDITVTQSNAIVRHAFPPRHDGHRSGAEGMDLRNRTVGLAYGRSGKFE
DAVPAYAAALRTHLQRYSSFLGDRVWFAGGELTACDFVMYELLDQNALMVPSCLEGFPTL
KAFCARFEALPAIKASKPQFTEHTDRKGG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgccagcaaaccagtggtgctcggctactgggcgatccgcgggcttgcgcaa
cccatccgcatgctcctcgaatactccagcatcccgtacgaggagaagcgcttcgaacag
ggaggcgccccagactttgacaagacctgctggactgacgtcaaggacactgtcctcggc
gactacccgtttccgaatctcccgttcctcatcgacggcgacatcacagtgacacagagc
aatgcgatcgtccgccacgcattccctcctcggcacgacggccaccgaagcggcgcggag
gggatggacttgcgcaaccggacggtcgggctggcctacggccgtagcggcaagttcgag
gatgcggtgccagcctacgctgctgctctacgcacgcacctgcagcggtactcgagcttt
ctcggcgatcgtgtgtggtttgctggcggcgagctgactgcgtgcgactttgtcatgtac
gagctgcttgatcagaacgcgctcatggtgcctagctgcctcgagggcttccccaccctc
aaggcgttctgcgccagatttgaggcgctgcccgccatcaaggcgagcaagccccagttc
acagagcacacagacagaaagggtgggtag

DBGET integrated database retrieval system