KEGG   Emiliania huxleyi: EMIHUDRAFT_202750Help
Entry
EMIHUDRAFT_202750 CDS       T02915                                 

Definition
(RefSeq) FAD-linked sulfhydryl oxidase
  KO
K17783  mitochondrial FAD-linked sulfhydryl oxidase [EC:1.8.3.2]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ehx03029]
    EMIHUDRAFT_202750
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     EMIHUDRAFT_202750
Mitochondrial biogenesis [BR:ehx03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    EMIHUDRAFT_202750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 17277537
NCBI-ProteinID: XP_005784570
JGI: Emihu1_202750
UniProt: R1F9P8
Position
Unknown
AA seq 148 aa AA seqDB search
MAPAPPPCEEKICASKNDKMRAMFAAVGQPKPAPAATAATSAECPPDREELGRHTWTLLH
TTAAYYPETASPSQQTLAEQFIRSLGELYALGSREEFCLWMCEQHNAVNAKLGKPVFPCT
LARLDARWRDGGARCDEEGAESSGPAID
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggctccgccgccgtgcgaggagaagatatgcgcgtccaagaatgacaagatg
cgtgcgatgtttgccgccgtcgggcagccaaagcctgctcccgctgcgaccgctgcgacc
tcggccgagtgcccgccggaccgtgaggagctcggacgacacacgtggaccctgctccac
accaccgccgcctactacccggagacggcctcgccgtcgcagcagaccctggctgagcag
ttcattcgctcgctcggcgagctctacgcgctgggctcgcgcgaggaattttgcctgtgg
atgtgcgagcagcacaacgccgtcaatgccaaactgggcaagcccgtcttcccgtgcacg
cttgccaggctcgatgcgcgctggcgcgacggaggcgcgcgctgcgacgaagaaggcgca
gagagctcaggccccgcgatagactaa

DBGET integrated database retrieval system