KEGG   Emiliania huxleyi: EMIHUDRAFT_233986Help
Entry
EMIHUDRAFT_233986 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00480  Glutathione metabolism
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EMIHUDRAFT_233986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ehx02000]
    EMIHUDRAFT_233986
Enzymes [BR:ehx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EMIHUDRAFT_233986
Transporters [BR:ehx02000]
 Other transporters
  Pores ion channels [TC:1]
   EMIHUDRAFT_233986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_2 GST_N_3 Antifungal_pept
Motif
Other DBs
NCBI-GeneID: 17274748
NCBI-ProteinID: XP_005781904
JGI: Emihu1_233986
UniProt: R1ESA0
Position
Unknown
AA seq 240 aa AA seqDB search
MLALQRPKFIRMGYWDIRGLGAPLRMLLAYSGVEHELVFHEEAEDSSWFEVKKPEMKKKN
ALANLPYLEVDDGSLVVCESNVCLMYLQDSLGLGPKSEAAKLQSYALLSMYMCTRNDMVN
RAYFEDVLSPPPCPTREAFDASMKDLLASGPFSKYEASLELSGTPFFAGETPCACDFAIW
EMLDQYTKLAADLAEPPPLANLPLCAAFHRRLRELPQLASYFASPAYALPCNSPALTHWN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgctgcagcgaccaaagttcatccgcatgggctactgggacattcgcgggctc
ggcgcgccgctgcgcatgctgctcgcctactccggtgtggagcacgagctcgtcttccac
gaggaggccgaggacagcagctggttcgaggtgaagaagccggagatgaagaagaagaac
gcgctggccaacctgccgtacctcgaggtcgacgacggcagcctggtcgtgtgcgagagc
aacgtgtgcctcatgtacctgcaggacagcctcggcctcgggccaaagtcggaggccgcc
aagctgcagagctacgcgctgctctccatgtacatgtgcacgcgcaacgacatggtcaac
cgcgcgtactttgaggacgtgctctcgccgccgccgtgcccgacgcgcgaggcctttgac
gcgtccatgaaggacctcctcgcgtccggccccttctccaagtacgaggccagcctcgag
ctgtcgggcacgcccttcttcgccggcgagacgccgtgcgcgtgcgactttgccatctgg
gagatgctcgaccagtacaccaagctcgccgccgacctcgccgagccgccgccgctcgca
aacctcccgctctgcgcggccttccaccggcggctgcgggagctgccgcagctggcgtcg
tactttgcgtcgccggcgtacgcgctgccgtgcaactcgcccgccctcacgcattggaac
tag

DBGET integrated database retrieval system