KEGG   Emiliania huxleyi: EMIHUDRAFT_309512Help
Entry
EMIHUDRAFT_309512 CDS       T02915                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00010  Glycolysis / Gluconeogenesis
ehx00020  Citrate cycle (TCA cycle)
ehx00620  Pyruvate metabolism
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
ehx01200  Carbon metabolism
Module
ehx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMIHUDRAFT_309512
   00020 Citrate cycle (TCA cycle)
    EMIHUDRAFT_309512
   00620 Pyruvate metabolism
    EMIHUDRAFT_309512
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EMIHUDRAFT_309512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-GeneID: 17278465
NCBI-ProteinID: XP_005785623
JGI: Emihu1_309512
UniProt: R1FIQ4
Position
Unknown
AA seq 425 aa AA seqDB search
MPALSPTMTQGNLVTWKKKEGDSIEAGDVIAEVETDKATVDYEAVDDGILAKILVPEGTE
DVLVGTSVAVVVDEAGDVGAFADYVPSSSTGNKAELAPAKPAPAPAPAAAAPPPPPAGVV
AAAAPRAAGAPVPASPLAKRMAAQMGIPLAALKGTGPGGRVIAADVKEPSAEEATTAKGA
APGAAVVPAGAEYIDLPNSNIRKVTAKNMVKNKNENPHYYVMMEIEMGALMGALEAKISV
NDYVIKAAALALKEVPACNSSYTDEYIRERCQYSAADISVAVNTDRGLLTPIVFGAASSR
WVFEDMWKAPTNAGYCEQTLAGLAKENKLKPEQFLGGTFTISNLGSMGVKQFTAIINAPQ
ACILAVGGADVKVVPDGKGGFTTKSVMVVSLSSDHRVVDGMIAAQFLKSFKKYMENPLLL
LLSAP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccctctcgcccacgatgacgcaagggaaccttgtgacgtggaagaagaaggag
ggtgacagcatcgaggcgggcgacgtgattgcagaggtggagaccgacaaggcgacggtc
gactacgaggccgtggacgacgggatcctcgccaagatcctcgtccccgagggcacagag
gatgtcctggtcggcaccagcgtggccgtcgtcgtggacgaggcgggtgatgtcggtgcc
ttcgcggactacgtgccgtcttcgagcacgggcaacaaagcggagctggcccccgcgaag
cccgcgcccgcgcccgcgcccgccgccgccgcgccgccgccgccaccggcgggcgtggtg
gccgccgcagcgccgagagccgctggcgcgcctgtgccagccagtccgctggcgaagcgg
atggcggcgcagatggggatcccgcttgccgccctcaagggcaccggcccgggcggccgc
gtcatcgccgcggacgtcaaggaaccgtccgcagaggaggcgacgacggcaaagggagcc
gcgcccggcgcggctgtggtgccagccggtgcggaatacatcgacctgccgaactcgaac
atccgcaaggtgaccgcgaagaacatggtcaagaacaagaacgagaacccccactactac
gtcatgatggagatcgagatgggtgctttgatgggcgcgctcgaggcgaagatctccgtc
aacgactacgtcatcaaggcggcggcgctcgcgctcaaggaggtgcccgcgtgcaactcg
tcgtacacggacgagtacatccgcgagcgctgccagtactccgccgccgacatctcggtc
gccgtcaacaccgaccgggggctgctcacgccaatcgtgtttggcgccgcctcctcaagg
tgggtctttgaagatatgtggaaggcgcccaccaacgcgggctactgtgaacagactctc
gcggggttggccaaggagaacaagctcaagcccgagcaattcctcggcggtactttcacc
atctccaacctcggatcgatgggcgtcaagcagttcaccgcgatcatcaacgcgccgcag
gcgtgcatccttgcggtgggcggcgcggacgtcaaggttgtccctgacggcaagggcggc
ttcacgacaaagtcggtcatggtcgtctccctctcgtcggaccaccgggtggtggacggc
atgattgccgcccagttcctcaagtcgttcaagaaatacatggagaacccgctcctgttg
ctcctgtctgctccctag

DBGET integrated database retrieval system