KEGG   Emiliania huxleyi: EMIHUDRAFT_310752
Entry
EMIHUDRAFT_310752 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ehx  Emiliania huxleyi
Brite
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     EMIHUDRAFT_310752
SSDB
Motif
Pfam: adh_short adh_short_C2 NAD_binding_10 Fer2_4
Other DBs
NCBI-GeneID: 17263980
NCBI-ProteinID: XP_005770201
JGI: Emihu1_310752
UniProt: R1C6E2
Position
Unknown
AA seq 332 aa
MHAPVIAPLLLAVYWTVMLLLSALMAPLALIDGITKAWADASATEAAPAERAGLAIVVTG
CDSGFGRSLAVALAERGYTVFAGCLSPESASSLTGIHRLRACKMDVTSDADVDSCVAAVH
AWVEEGRGARRLLSVVSNAGRGAGGWVDWLSMGDYESDIAVNFLGVVRVSKSFLPLLRRS
AAAAAGSPFAAPPRLLIVSSMSGKLPLANVWGVHVSTALPSFHRTPLTTGGVGVLVRKWT
SLGGEARALYGDHCAESCFRIADGMMSDWAWEPERVTEALARAATSRGAPPAELNLLRHL
PAAALETVIWRWYASELVPPAGASADGKGRAS
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcacgctcccgtgatcgcgccgctcctgcttgccgtgtactggacggtgatgctgctg
ctctctgcgctgatggcgccgctggcacttatcgacggcataaccaaggcgtgggccgat
gcgagcgccaccgaggcggcgccggcagagcgagcaggcctggcgatcgtcgtcacgggt
tgcgactcgggatttgggcgctcgctcgccgtggcgctcgccgagcgcggatacaccgtt
tttgcgggctgcctctccccagagagcgcgtcgtcgttgaccgggatacaccgtcttcgc
gcctgcaagatggacgtcacgtcagacgccgacgtcgacagctgcgtggcggcggtgcac
gcgtgggtggaggaggggcgcggggcgaggaggctgctcagcgtcgtgagcaacgccggc
cgcggcgccggcggctgggtggactggctctcgatgggcgactacgagagcgacatcgcc
gtcaacttcctcggcgttgtgcgcgtgagcaagtccttcctcccgctcctccgccgcagc
gccgccgccgcggcaggcagtccatttgccgcgccgccgcgcctcctcatcgtctcgtcc
atgtcgggcaagctgcccttggccaacgtgtggggcgtgcacgtgagcacggcgctcccc
tccttccaccgcacgccgctcaccaccggcggcgtgggcgtgctggtgcggaagtggacc
tcgctcggcggagaggcgagggcgctctacggcgaccattgcgccgagtcctgcttccga
atcgccgacgggatgatgtccgactgggcctgggagccagagcgcgtgacggaggcgctc
gcgcgcgccgccaccagccgcggcgcgccgcccgcagagctcaacctgctgcggcacctg
cctgccgccgcgctcgagaccgtcatctggcggtggtacgcgagcgaacttgtgccgccg
gccggggcgagcgcggacgggaaggggcgcgcgagctga

DBGET integrated database retrieval system