KEGG   Emiliania huxleyi: EMIHUDRAFT_311681Help
Entry
EMIHUDRAFT_311681 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ehx  Emiliania huxleyi
Pathway
ehx03040  Spliceosome
ehx04141  Protein processing in endoplasmic reticulum
ehx04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    EMIHUDRAFT_311681
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EMIHUDRAFT_311681
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    EMIHUDRAFT_311681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ehx01009]
    EMIHUDRAFT_311681
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ehx03041]
    EMIHUDRAFT_311681
   03009 Ribosome biogenesis [BR:ehx03009]
    EMIHUDRAFT_311681
   03110 Chaperones and folding catalysts [BR:ehx03110]
    EMIHUDRAFT_311681
   04131 Membrane trafficking [BR:ehx04131]
    EMIHUDRAFT_311681
   03051 Proteasome [BR:ehx03051]
    EMIHUDRAFT_311681
   03029 Mitochondrial biogenesis [BR:ehx03029]
    EMIHUDRAFT_311681
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ehx04147]
    EMIHUDRAFT_311681
Protein phosphatases and associated proteins [BR:ehx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EMIHUDRAFT_311681
Spliceosome [BR:ehx03041]
 Complex B
  Other components
   Prp19 complex
    EMIHUDRAFT_311681
 Complex C
   Prp19-CDC5 complex
    EMIHUDRAFT_311681
Ribosome biogenesis [BR:ehx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    EMIHUDRAFT_311681
Chaperones and folding catalysts [BR:ehx03110]
 Heat shock proteins
  HSP70 / DNAK
   EMIHUDRAFT_311681
Membrane trafficking [BR:ehx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    EMIHUDRAFT_311681
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    EMIHUDRAFT_311681
Proteasome [BR:ehx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    EMIHUDRAFT_311681
Mitochondrial biogenesis [BR:ehx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    EMIHUDRAFT_311681
Exosome [BR:ehx04147]
 Exosomal proteins
  Proteins found in most exosomes
   EMIHUDRAFT_311681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 17257026
NCBI-ProteinID: XP_005763388
JGI: Emihu1_311681
UniProt: R1DQM3
Position
Unknown
AA seq 521 aa AA seqDB search
MIPNSNGAHTTASWVAFAKEDGTRLVGDAAKNQAASNPGNTVNDAKRLIGRAFSESAVQA
DAKHLSCRVEEGPSGKPMIAVEVCGEKRSFAPEQISAMVLEQLKADAEAFLGQAVKRAVI
TVPAHFNDAQRQATKDAGTIAGLDVLRIINEPTAAAIAYGLDKARGGKAERNGGIFEVKA
TGGDTRLGGEDFDAATTKWLEQQFLKSHPGVAIDARGRRRLIAAAERAKRHLSSQTTAEV
EIEAFSDGHDLKVPLSRAKFESINAAFFSSCIDTVKKVLKDSGLAKEEIDEVVLVGGSTR
VPKIRSLLSDYFGGKQLCSSINPDEAVAYGAAVQAGVLSGGLAAAGGALAKASTGLVLMD
VVPLSLGIETTGKVMATIVKRNTPIPCRRVDTFTTEEDGQTAIDVAIFEGERASTDACSK
LGEFTITGIERAKRGEPQIEVSMDIDANGILSVSAKDKTTGAKASTTIAATASRNSNEDV
ARMVEEARVNAAADKVLREKAEAKRLLEDAIFDPPPRVREP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatccccaactccaacggcgcccacacgacggcgtcgtgggtcgcgtttgccaaggag
gacggcacgcggctggtcggcgacgccgccaaaaaccaggcggcgtccaacccaggcaac
accgtcaacgacgcgaagcggctcatcgggcgcgccttctcggagagcgccgtgcaggcc
gacgcgaagcacctctcgtgccgcgtggaggagggcccgtccggcaagccgatgatcgcg
gtcgaggtttgcggtgagaagcgctcgtttgcgccagagcagatcagcgccatggtgctg
gagcagctcaaggcggacgcggaggcgttcctcgggcaggccgtcaagcgcgccgtcatc
accgtccccgcccacttcaacgacgcccagcgccaggcgaccaaggacgcaggcaccatc
gctgggctcgacgttctgcgcatcatcaacgagccgaccgccgccgcgatcgcgtatggc
ctcgacaaggccagggggggcaaggcggagcgcaacggcggcatcttcgaggtcaaggcg
acgggcggcgacacgcggctgggcggggaggacttcgacgcagccacgaccaagtggctg
gagcagcagttcctcaagtcgcacccgggcgtcgcgatcgacgcgcgcggccggcggcgc
ctcatcgccgccgcggagagggcgaagcggcacctctcctcgcagacgacggccgaggtc
gagatcgaggccttctcggacgggcacgacctcaaggtgccgctgagccgcgccaagttc
gagtcgatcaacgcggccttcttcagctcgtgcatcgacaccgtcaagaaggtgctcaag
gactccggactcgccaaggaggagatcgacgaggtcgtgctggtcggcggctcgacccga
gtgccaaagatccgctcgctgctctccgactacttcggcggcaagcagctctgctcgtcc
atcaaccccgacgaggcggtcgcgtacggcgcggcggtgcaggcgggcgtcctctcgggc
ggcctcgcggcggcgggcggtgccctcgccaaggcctcgaccgggctcgtgctgatggac
gtggtgccgctctcgctcggcatcgagacgacgggcaaggtgatggccacgatcgtcaag
cgcaacacgcccatcccgtgccgccgcgtcgacaccttcaccaccgaggaggacgggcag
accgccatcgacgtcgccatcttcgagggcgagcgcgcctcgaccgacgcctgctcaaag
ctgggcgagttcaccatcaccggcatcgagcgcgccaagcgcggcgagccgcagatcgag
gtctcgatggacatcgacgcgaacggcatcctctccgtctcggccaaggacaagacgacc
ggcgccaaggcctcgaccaccatcgccgccaccgcgtcgcgcaactccaacgaggacgtc
gcgcgcatggtcgaggaggcgagggtgaacgccgccgcagacaaggtgctgcgcgagaag
gcagaggccaagcgcctcctcgaggacgccatctttgaccccccaccccgagtccgtgaa
ccgtga

DBGET integrated database retrieval system