KEGG   Emiliania huxleyi: EMIHUDRAFT_369159Help
Entry
EMIHUDRAFT_369159 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ehx01001]
    EMIHUDRAFT_369159
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EMIHUDRAFT_369159
Protein kinases [BR:ehx01001]
 Serine/threonine kinases: TKL group
  IRAK family
   EMIHUDRAFT_369159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 17265835
NCBI-ProteinID: XP_005772725
JGI: Emihu1_369159
UniProt: R1EBA7
Position
Unknown
AA seq 171 aa AA seqDB search
MRGGSLEARLCISNPDRAAQLRRLGMAEAPRPLTWRQRVCIACEATEALVYLHSKGIVHR
DVKPDNILLDEKLTAVLADTGFAKDQRPDASVRCRSTALYMSTGYLCPSISKGGEYSPKT
DGYAVGITLLVCLTNRSEVQLTDRCEEEFDELWTNIDASQIADAAAGWTAT
NT seq 514 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcggctcgctcgaggcgcggctgtgcatctcgaatcccgaccgagcggcgcag
ctccggcggctggggatggcggaggcgccgaggccgctgacgtggcgacagcgcgtttgc
attgcgtgtgaggcgaccgaggcgctcgtctacctccactcgaagggcatcgtgcaccgc
gacgtcaagccggacaacatcctgctcgacgagaagctcaccgccgtcctcgccgacact
ggtttcgccaaggaccagcgtcccgacgcgtctgtccgctgccgctcgaccgccctttac
atgtccacgggctacctctgcccctccatctccaaggggggcgagtactcgccaaagacc
gacggctacgcggtcggcatcaccctcctcgtctgcctaaccaaccggtccgaggtgcag
ctgaccgaccggtgcgaggaggagtttgacgaactctggaccaacatcgacgcgtcccag
atcgcagacgcggcggcggggtggaccgcaactg

DBGET integrated database retrieval system