KEGG   Emiliania huxleyi: EMIHUDRAFT_417170Help
Entry
EMIHUDRAFT_417170 CDS       T02915                                 

Definition
(RefSeq) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00450  Selenocompound metabolism
ehx00970  Aminoacyl-tRNA biosynthesis
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EMIHUDRAFT_417170
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EMIHUDRAFT_417170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ehx01007]
    EMIHUDRAFT_417170
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ehx03016]
    EMIHUDRAFT_417170
Enzymes [BR:ehx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EMIHUDRAFT_417170
Amino acid related enzymes [BR:ehx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EMIHUDRAFT_417170
Transfer RNA biogenesis [BR:ehx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EMIHUDRAFT_417170
 Prokaryotic type
   Other AARSs
    EMIHUDRAFT_417170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Phage_GPD tRNA-synt_1b DUF2397
Motif
Other DBs
NCBI-GeneID: 17250649
NCBI-ProteinID: XP_005756921
JGI: Emihu1_417170
UniProt: R1B615
Position
Unknown
AA seq 693 aa AA seqDB search
MGHAYEGVCADVIARYHRAYGREVFFLTGADEHGQKISDTAAAQGIRPIELCDRAVAGFR
ALNAKLGVSNDFYVRTTSPAHKAACQALWRRAVESGDVYLGSYEGWYNVREETFVTETEA
QASEYKDPVSGVPLQKMQESSYMFKMAKYHEQVEAHIRSHPEFIQPESRRNEILDRLKEP
LRDLSVSRATFTWGIPVPGDEKHVMYVWFDALTNYLSGIEYGSGGKDGFWPCDVHLIGKD
IIWFHCIIWPALLLSLGIPLPRCVLAHGFVHGSDGRKMSKSLGNVVDPLDVLTRHSVDVF
RFFLVRDAPFGGDLTFSEDALVLRQNAELADNYGNLVQRATVLCKKDCGGVVPAAEADAV
VDLSALREAVEAEMQRFAIDQALYLVLRALDVANKYVTDAAPWKLPAGDPKRRVVVRTLL
EVIYACTHFLAPVLVDAAQRVWEKLGTPPVPIWRLRPTLSNLVPGTPVAASASKDDVLFA
KGETEGARARLEEEAAKKRAAKEAQAARAAAEQAAAARAAAGGGGGVAEELHKLDLRVGR
VLKVERHSEADSLYVEEVDLGEPTGPRRVVSGLVKYMTAEALLGRRVVLLANTKPSKLKG
VESQAMLLCAFAADGSAVELVEPPPAAPLGERVVFDGHDAPPEKQLNPRKKLWDRLQPEM
NTAPDGTARFQQLPFSTPHGPCKCASIAGGAIK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgggccacgcgtacgagggcgtctgcgccgacgtcatcgctcgctaccaccgcgcgtac
ggccgcgaggtcttcttcctgaccggtgccgacgagcacggccaaaagatcagcgacacg
gccgctgcgcagggcatccggcccatcgagttgtgcgaccgcgccgtcgccggcttccgc
gcactcaacgccaagctgggcgtctcgaacgacttttacgtgcgcacaacttcgcctgcg
cacaaggcggcctgccaggcgctgtggcggcgggcggtcgagagcggcgacgtgtacctc
gggtcgtacgaggggtggtacaatgtgcgcgaggagacgtttgtcaccgagaccgaggcg
caggcgtccgagtacaaggaccccgtctcgggcgtgccgctgcagaagatgcaggagtcg
tcctacatgttcaagatggccaagtaccacgagcaggtcgaggcccacatccggtcccac
cccgagttcatccagcccgagagtcggcggaacgagatcctcgaccggctcaaggagccg
ctgcgcgacctctccgtctcgcgcgccacgttcacatggggcatccctgtgccgggcgac
gagaagcacgtgatgtacgtctggttcgacgcgctgacaaactacctgtctgggatcgag
tacggcagcggcggcaaggacggcttctggccgtgcgacgtccacctcatcggcaaagac
atcatctggttccactgcatcatctggcccgcgctgcttctctcgctgggcatcccgctg
cctcgctgcgtcctcgcgcacgggttcgtccacggcagcgacgggcgcaagatgagcaag
tcgctcggcaatgtggtcgaccctctcgacgtgctcacgcgccactccgtcgacgtgttc
cgcttcttcctcgtgcgggacgcgcccttcgggggcgacctcaccttctccgaggatgcg
ctcgtgctgcggcagaacgcagagctcgcggacaactatggcaacctggtgcagcgagcg
acggtgctgtgcaagaaggactgcggcggcgtggtgcccgcagcggaggccgatgccgtg
gtcgacctgtcggcgctgcgcgaggcggtggaggcggagatgcagcgcttcgccatcgac
caggcgctctacttggtgctgcgcgcactcgacgtggccaacaagtacgtgaccgacgcg
gccccttggaagctccctgccggcgacccgaagcggcgggtggtcgtgcgaaccctgctc
gaggtgatctacgcgtgcacgcacttcctcgcccccgtgctcgtcgacgccgcccagagg
gtgtgggagaagctcgggacgccccccgtcccgatctggcgcctccgcccgacgctgtcc
aacctggtccccggaacgccggtcgcggcgagcgcgtccaaggacgacgtgctgttcgct
aagggcgagacggagggcgcacgggcgcggctcgaggaggaggctgccaagaagagggcg
gccaaagaggcgcaggccgcgcgcgccgcggcggagcaggcggcggcggcgcgggcggcg
gcgggcggcggcggcggcgtggcggaggagctgcataagctcgatttgcgcgtcgggcgc
gtgctcaaggtggagcggcactccgaggcggactcgctgtacgtggaggaggtcgacttg
ggcgagccgacgggtcctcgtcgcgtcgtgtctgggctggtgaagtacatgactgcggag
gcgctgctggggcggcgtgtcgtgctgctggcaaacacaaagccgagcaagctcaagggc
gtcgagtcgcaggcgatgctgctctgcgccttcgccgccgacggcagcgcggtcgagctg
gtggagccgccgccggccgcgccgctcggcgagcgggtcgtgtttgacgggcacgacgcg
ccgcccgagaagcagctcaaccctcgcaagaagctgtgggacaggctgcagcccgagatg
aacaccgcgcccgacggcaccgcccgcttccagcagctgcccttctcgacgccgcacggg
ccctgcaagtgcgcctccatcgccggaggcgcaatcaagtga

DBGET integrated database retrieval system