KEGG   Emiliania huxleyi: EMIHUDRAFT_418599Help
Entry
EMIHUDRAFT_418599 CDS       T02915                                 

Definition
(RefSeq) arginine-tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EMIHUDRAFT_418599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ehx01007]
    EMIHUDRAFT_418599
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ehx03016]
    EMIHUDRAFT_418599
   03029 Mitochondrial biogenesis [BR:ehx03029]
    EMIHUDRAFT_418599
Enzymes [BR:ehx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     EMIHUDRAFT_418599
Amino acid related enzymes [BR:ehx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   EMIHUDRAFT_418599
Transfer RNA biogenesis [BR:ehx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EMIHUDRAFT_418599
 Prokaryotic type
   Other AARSs
    EMIHUDRAFT_418599
Mitochondrial biogenesis [BR:ehx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EMIHUDRAFT_418599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 17273713
NCBI-ProteinID: XP_005780596
JGI: Emihu1_418599
UniProt: R1CZI2
Position
Unknown
AA seq 614 aa AA seqDB search
MPSTSAPPTLLQALTAICTRALEASFPGISCAIHVAPSTKGAHYQNNTAMPLFKALKDAG
RSAEAASPKAVAEKLAAQMTACDTDGLLARCEVAGPGFINIFVAPAYLESTVNSILRHGP
MPPPCAPKRVVVDFSSPNVAKEMHVGHLRSTIIGDTISRLLEFCGHRVDRVNHVGDWGTQ
FGMLIGHLKNVFPDYATKPPPIGDLQQFYKDAKKVFDDDEAFKKVAHAEVPCPRQAGDAD
SRFAWRQICEVSRREFEKVYSRLQVELEEVGESFYNEYIPPVIRHLTEIGVAHDSDGAMV
LFPPGTKHEQPLIVRKSDGGFGYDSTDMAAVWYRLLELQADWLVYVTDAGQSQHFELIFA
AARQAGWVGDKRLDHCPFGLVCGDDGKKFKTRSGDATRLVDRLLDGASRSLLGTSLWDAD
VAAGKLEPYTDEELLETARVMGYGAVKYADLKGGRVNDYIFSYERMLDDKGGADRPLTAR
SPRRRERNTAVYLLYAGARLSSIQRKAAATSGASAAELVASGAGVALSMPTELELALALA
RFGETVEFTTQTLLPNKLCEYVHDVCVKFTAFYLECKVIEEDAVNQSRLLLVRAAQLVIK
KANELLGIGYVDKV
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgaccagcgctccaccgacgctgctccaggcgctcaccgccatctgcacgcgg
gcgctcgaggccagcttccccggcatcagctgcgccatccacgtggcgcccagcaccaag
ggcgcgcactatcagaacaacaccgcgatgccgctcttcaaggcgctcaaggacgcgggc
cgctcggccgaggcggcgagccccaaggccgtcgccgagaagctcgcggcgcagatgacc
gcctgcgacaccgacgggctgcttgcgcggtgtgaggtggccggccctggcttcatcaac
atctttgtcgcgccggcgtacctcgagtcgaccgtcaactcgatcctgcggcacggcccg
atgccgccgccctgtgctcccaagcgggtggtggtcgacttctcctcgccaaacgtggcc
aaggagatgcacgtcggccacctgcgctccaccatcatcggcgacaccatctcgcggctg
ctcgagttttgcggccaccgggtcgaccgggtgaaccacgtgggcgactggggcacgcag
ttcggcatgctgatcggccacctgaagaacgtcttccccgactacgccactaagccgccg
ccgatcggcgacctgcagcagttctacaaggacgccaagaaggtcttcgacgacgacgag
gccttcaagaaggttgcgcacgccgaggtcccctgtccccgtcaggcgggcgacgcggac
tcgcgcttcgcgtggcggcagatctgcgaggtgtcgcgccgcgagttcgagaaggtgtac
tcgcggctgcaggtcgagctggaggaggttggcgagtccttttacaacgagtacatcccg
cccgttatccgccacctcaccgagatcggcgtcgcgcacgactcggacggcgcgatggtc
ctcttcccgcccggcaccaagcacgagcagccgctcatcgtgcggaagagcgacggcggc
ttcgggtacgactcgaccgacatggccgccgtctggtaccggctgctcgagctgcaggcg
gactggctcgtctacgtgaccgacgcgggccagtcgcagcacttcgagctcatctttgcg
gcggcgcgccaggcggggtgggtgggcgacaagcggctcgaccactgcccgttcggcctc
gtctgcggcgacgacggcaagaagttcaagacgcgctccggcgacgccacgcggctggtc
gaccgactcctcgacggcgcttctcggagcctgctcggcacctccctgtgggacgcagac
gtggctgcggggaagctcgagccgtacacggacgaggagctcctcgagacggcgcgcgtg
atggggtacggcgccgtcaagtacgcagacctcaagggcggccgcgtcaacgactacatc
ttctcgtacgagcggatgctcgacgacaagggcggcgctgaccgcccgctcaccgcccgc
tcgccgcgccggcgagagcgcaacaccgctgtctacctgctctacgccggcgcgcgcctc
tcgtccatccagcgaaaggcggccgccacgagcggcgcctctgccgccgaactcgtcgcc
tcgggcgccggcgtcgcgctgagcatgccgaccgagctcgagctcgcgctggcgctggcg
cgcttcggcgagacggtcgagttcaccacgcagacgctgctgcccaacaagctctgcgag
tacgtccacgacgtgtgcgtcaagttcaccgccttttacctggagtgcaaggtgatcgag
gaggacgccgtcaaccagtcgcggctgctgctcgtgcgcgccgcgcagctcgtcatcaaa
aaggcgaacgagctcctcggcatcggctacgtcgacaaggtctaa

DBGET integrated database retrieval system