KEGG   Emiliania huxleyi: EMIHUDRAFT_431431Help
Entry
EMIHUDRAFT_431431 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00010  Glycolysis / Gluconeogenesis
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
ehx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMIHUDRAFT_431431
Enzymes [BR:ehx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EMIHUDRAFT_431431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 17250476
NCBI-ProteinID: XP_005756754
JGI: Emihu1_431431
UniProt: R1CPV4
Position
Unknown
AA seq 293 aa AA seqDB search
MKVEQTSRNGLPAVLLTHASGSSALIYIYAAHLASWVCGGAERLFVSSTAEYGGGKAIRG
GVPVCWPQFAGRGALPKHGFVRTSDKWRVLRTSTEPYPCVVLELVDDDETRRLFPQPFKL
QYSVTLDGPSSISMALSVLNTGTEPLSFTAALHTYFRVADVRGVSLHGLGGLRYEDNTRA
NAVETQPEGPLSIAGEVDRVYLDAPAEAHIVDGASAIKVLKLGFPDAVLWNIGERAAGGI
KDLAPGEWQHYLCYEAGAVAKPATVPASASWTGGQTFSCVDACDALGKLSLGK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgagcagacctcccgcaacggcctgccggcggtgctcctcactcacgcatcg
ggctcatccgcgctcatctacatctacgccgcccacctcgcctcttgggtctgcggcggc
gccgagcgcctctttgtctcctccaccgccgagtacggcggcggcaaggccatccgcggc
ggcgtgcccgtctgctggccgcagttcgccgggcgcggtgctcttccgaagcacggcttc
gtgcgcacctcggataagtggcgagtgctgcgcacctccacggagccatacccgtgcgtc
gtgctcgagttggtggacgacgacgagacgcggcgcctcttcccgcagcccttcaagctg
cagtactcggtcacgctcgacggcccctcctccatctcgatggcgctctccgtcctcaac
actggcaccgaacccctctccttcaccgccgcgctgcacacctactttcgcgtcgccgac
gtgcgcggcgtctctctgcacgggcttggcggactccggtacgaggacaacacgcgcgca
aacgcagtggagacgcagcccgagggaccgctctccatcgccggcgaggtggaccgcgtc
tacctggacgcccccgccgaggcgcacatcgtcgacggggcgagcgccatcaaggtgctc
aagctcgggttcccggacgccgtactgtggaacatcggcgagcgggcggcgggcggcatc
aaggacctcgcccccggggagtggcagcactatctctgctacgaggctggcgccgtcgcg
aagcccgccacggtgcccgcgtctgcgtcgtggacaggagggcagaccttcagctgcgtc
gacgcgtgcgatgcgctgggcaagctctccttgggcaagtga

DBGET integrated database retrieval system