KEGG   Emiliania huxleyi: EMIHUDRAFT_433509Help
Entry
EMIHUDRAFT_433509 CDS       T02915                                 

Definition
(RefSeq) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00350  Tyrosine metabolism
ehx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehx00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    EMIHUDRAFT_433509
Enzymes [BR:ehx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     EMIHUDRAFT_433509
Exosome [BR:ehx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EMIHUDRAFT_433509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 17283259
NCBI-ProteinID: XP_005790418
JGI: Emihu1_433509
UniProt: R1FX02
Position
Unknown
AA seq 293 aa AA seqDB search
MISLKPFSGATTRALRSRSFHAGAGAFSPLSAARASAISRPAPPVRWDSNDAARPPSATS
DFNELRERSLLRHVISSSTEGDPASVLDAMDVFWDTYFNGAGTAEWKLRSQAIDRAVEEV
HAKRGPEAYVMELGTYCGYTAVRMGRLLPPGAKLVSVEIEPLFAAIASTVVEHAGLRDRV
EVRIGSVADRLPSIQAKHGARPLDAVLLDHSIKDFLPDLRLLESNGMINSDTAVLCDWNL
YPGTQDGRDEAPQAGTEFMDYLKKIVSDQDITTTKHSVGDKDVFTVSTWSGVV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatctccctcaagcccttttcgggcgcgacgacgcgcgcgctgcggagccggagcttc
cacgcgggcgcgggcgccttcagcccgctgtcggcggcgcgcgcctcggcgatctcgcgc
cctgcgccgcccgtgcgctgggactcaaacgacgctgcgcggccgccctctgcgacctcg
gacttcaacgagctgcgcgagcgctcgctgctgcggcacgtgatcagctcgtcgacggag
ggcgatccggcctcggtgctcgacgcgatggacgtcttctgggacacgtacttcaacggc
gctggcacggccgagtggaagctgcgcagccaggccatcgaccgcgccgtcgaggaggtg
catgcgaagcgcgggccggaggcgtacgtgatggagctgggcacgtactgcggctacacc
gccgtccggatgggccgcctcctcccgcccggcgccaagctcgtctcggtcgagatcgag
ccgctgtttgccgcgattgcgtcgaccgtggtcgagcacgcggggctgcgggaccgcgtg
gaggtgcggatcgggtcagtggccgatcggctcccgtcgatccaggctaagcacggcgct
cggcctctcgacgcagtgctgctcgaccactccatcaaggacttcttgcccgacctgcgg
ctgctcgagtccaacggcatgatcaacagtgacacggccgtgttgtgcgactggaacctg
taccccggcacgcaggacggccgggacgaggcgccgcaggcgggcactgagttcatggac
tatctcaagaagattgtctcggaccaggacatcaccaccacgaagcactctgtcggcgac
aaggacgtcttcaccgtctcgacttggtcgggggtcgtctag

DBGET integrated database retrieval system