KEGG   Emiliania huxleyi: EMIHUDRAFT_436308Help
Entry
EMIHUDRAFT_436308 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K08819  cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ehx01001]
    EMIHUDRAFT_436308
Enzymes [BR:ehx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     EMIHUDRAFT_436308
    2.7.11.23  [RNA-polymerase]-subunit kinase
     EMIHUDRAFT_436308
Protein kinases [BR:ehx01001]
 Serine/threonine kinases: CMGC group
  CDK family
   EMIHUDRAFT_436308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 17263848
NCBI-ProteinID: XP_005770248
JGI: Emihu1_436308
UniProt: R1EA98
Position
Unknown
AA seq 474 aa AA seqDB search
MVGDGKGAVTEGGPSGASRSIKLYEKVEQVGEGTYGQVYKARSRESGEIVALKRVRMDNE
KEGFPITAIREIKILKVLNHKNIVRLHEIVTSDASDYNHGKGSIYMVMEYCDHDLTGLSD
SGHRFSPGQIKCYMKQLLEGICYCHKNHVLHRDIKGSNLLINESGQLKLADFGLARPFDD
QSKAYTNRVITLWYRPPELLLGETHYGPAIDLWSAGCILAELLLRKPILPGRNEFEQLDL
VFKLLGTPTEQSWPGVSKLAYFDMMTKQNGGRHYMSRFDDKFAALEPMGKDLLRKLLAMD
PSRRITAKEALDHDYFWTPPLPTKPEDLPKYPACHEFTAKKRRQQAAQNVPPAAATQQQP
QGATTHWAGAHQRPQHAPSQQQYGGHYQQYGHAAPQYGQPSQQQYGHPSHGPPSFAPGYA
GAGYHGGGGVKRGREPYDPTNPRGPQGALSLPVSRGGPPQHAGRPAGYANGYGR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgacggcaagggggcagtgacggagggtgggccctcaggggcctcgcgcagc
atcaagctgtacgaaaaggtggagcaggttggggaggggacgtacggccaggtgtacaag
gcgcgctcgcgcgagtcgggtgagattgtggcgctcaagcgggtgcggatggacaacgag
aaggagggcttcccgatcacggccatccgcgagatcaagatcctcaaggtgctcaaccac
aagaacatcgtccgcctgcacgagatcgtgacctccgacgcgtcagactacaaccacggc
aagggctccatctacatggtgatggagtactgcgaccacgacctgaccgggctgtccgac
tcggggcaccgcttctcgccggggcagatcaagtgctacatgaagcagctcctcgagggc
atctgctactgccacaagaatcacgtcctccaccgagacatcaagggctcgaaccttctc
ataaacgagtcgggacagctcaagctcgccgactttgggctcgcgcgcccctttgacgac
caatcaaaggcgtacaccaaccgcgtcatcacgctgtggtaccggccgcccgagctgctg
ctcggtgagacgcactacggtcccgccatcgacctctggtccgctggctgcatcctcgcc
gagcttctcctccgcaagcccatcctgcccggccgcaacgagttcgagcagctcgacctc
gtcttcaagctgctcggcacgccgacggagcagtcgtggcccggcgtctccaagctcgcc
tacttcgacatgatgaccaagcagaacggcggccggcactacatgtcgcgctttgacgac
aagttcgccgcgctcgagccgatgggcaaggatttgctccgcaagctcctcgcgatggac
ccgtccaggcgcatcaccgccaaggaggcgctcgaccacgactacttttggacacccccc
ctgccgacgaagcctgaagacctaccaaagtacccggcctgtcacgagttcacggccaag
aaacggcgccagcaggccgcacagaatgtgccgcccgccgccgccacgcagcagcagccc
caaggggcgacaacccactgggccggcgctcaccagcgcccccagcacgcgccctcgcag
caacagtacgggggccactaccagcagtatggccatgctgcgccgcagtatggccagcca
tcgcagcagcagtacggacacccgtcccacggcccaccctccttcgcccccggctacgct
ggggccggctaccacggcggaggaggagtcaagcgcggacgggagccgtacgacccaaca
aacccgagggggccgcaaggcgcgctttccctgcccgtgagccgcggcggcccgccacag
cacgcgggtcgccccgcaggctacgccaacggctacggccgctga

DBGET integrated database retrieval system