KEGG   Emiliania huxleyi: EMIHUDRAFT_439552Help
Entry
EMIHUDRAFT_439552 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K15397  3-ketoacyl-CoA synthase [EC:2.3.1.199]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00062  Fatty acid elongation
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    EMIHUDRAFT_439552
Enzymes [BR:ehx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     EMIHUDRAFT_439552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAE1_CUT1_RppA Chal_sti_synt_C ACP_syn_III_C Chal_sti_synt_N
Motif
Other DBs
NCBI-GeneID: 17285964
NCBI-ProteinID: XP_005793122
JGI: Emihu1_439552
UniProt: R1DZ47
Position
Unknown
AA seq 622 aa AA seqDB search
MSLRRQFSQNPPPPLRTGSETEEPLEKASQWARAPHEWITQRVDIVRGFVASDLSDYVMR
FSMLLLGAYTLYLAWCESCKADYLAYLAGVGEALLDFVTLTRGSLAGATVAVCLSVWLLT
VRWMRRPAPIYLIDFKTYRHCGVDGGDRDSTAGVPASQERFMAESRAALNRFGEPCFTEK
SIEFQEKIMKTSGISEMSIFPESILPKSGQNPLGKDAEVLGLSMKGAREEAEAMMCKTVA
DLLAATGTAAEDIGIVIVNCSLFCPTPSLSAMLVNHFKMRSDCLTYNLGGMGCSAGGISI
DLARRLLRGHEQKGSLALVVSTENITQNWYRGNDRGMLLQNTLFRCGAAAILLSNRGSDA
GRARFKLLHTVRTHVGKDDLAYNSVIQEEDADGIRGVRLSKAIMQIAGDALKRNITALGP
LVLPLKEQLKFFFNMVARTAARGKAGKPVKSLARSLVPLPLFRSLVNFTPDPADQPLPSP
KPAARAAGKLSPPRPRPEKPEDPLLKALPPYVPDFTAAFEWICVHTGGRAVIDAMEKNLA
LPSHYLEPSRLSLYRYGNVSSASIWYELELIAENGNQCGAHRPDGNLPAVPRKLRRGDRV
WQIAFGSGFKCNSVVWQCMRGS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccctccgccgtcagttctcccagaacccgccgccgccgctccgcacgggctcggag
acggaggagccgctggagaaggcgtctcaatgggcccgcgccccgcacgagtggatcacg
cagcgggttgacatcgtgcgcggctttgtcgcgagcgacctctccgactatgtgatgcgc
ttctcgatgctgctgctcggcgcctacacgctctacctcgcgtggtgcgagtcctgcaag
gccgactacctcgcctatctcgccggcgtcggcgaggcgctgctcgactttgtgacgctg
acgcgcggctccctcgcgggcgcgacggtcgcggtgtgcctctccgtgtggctgctgacc
gtccggtggatgcgccggccggcgcccatctacctcatcgacttcaagacgtaccggcac
tgcggcgtcgacggcggcgaccgcgactccacggcgggcgtgccggcgtcgcaggagcgc
tttatggccgagtcgcgggccgcgctcaaccggttcggcgagccgtgcttcacggagaag
tcgatcgagttccaggagaaaatcatgaagacgtcgggcatctcggagatgtccatcttc
cccgagtccatcctccccaagagtggccagaaccccctcggcaaggacgccgaggtgctc
ggcctctcgatgaagggcgcgcgcgaggaggcggaggcgatgatgtgcaagacggtggcg
gacctgctggcggcgacggggacggcggcggaggacatcgggatcgtcatcgtcaactgc
tccctcttctgccccaccccctccctctccgccatgctcgtcaaccacttcaagatgcgc
tccgactgcctcacctacaacctcggaggcatgggctgctcggcgggcggcatctcgatc
gacctcgcgcgccggctgctgcgtgggcacgagcagaagggctcgctcgcgctcgtcgtc
tccaccgagaacatcacccagaactggtaccgcggcaacgaccgcggcatgctgctgcaa
aacacgctcttccgctgcggcgccgcggccatcctgctctccaaccgcgggtcggacgcg
gggcgggcgcgcttcaagctgctgcacacggtgcgcacccacgtcggcaaggacgacctc
gcctacaactcggtcatccaggaggaggacgccgacggcattcgcggcgtccgcctctcc
aaggcgatcatgcagatcgcgggcgacgcgctcaagcgcaacatcacggcgctcggcccg
cttgtgctgccgctcaaggagcagctcaagttcttcttcaacatggtcgcccggacggcc
gcccgcggcaaggcgggcaagcccgtcaagtcgctcgcccgctcgctcgtcccgctgccg
ctcttccgctcgctggtcaacttcacgcccgacccggccgaccagccgctgccgtcgcca
aagccggccgcccgcgcggcgggcaagctgagcccgccgcggcccaggccggagaagccc
gaggacccgctcctcaaggcgctgcctccgtacgtccccgacttcaccgccgccttcgag
tggatctgcgtccacacgggaggccgcgccgtcatcgacgcgatggagaagaacctcgcg
ctgccgtcgcactacctcgagccgtcgcgcctctcgctctaccggtacggcaacgtctcc
tccgcctcgatctggtacgagctcgagctcatcgcggagaatggaaaccagtgcggagcc
caccggcccgacggcaacctgccggcggtgccgcgcaagctgcgccgcggcgaccgcgtg
tggcagatcgcgtttggctcgggctttaagtgcaactcggtcgtctggcagtgcatgcgc
ggctcctga

DBGET integrated database retrieval system