KEGG   Emiliania huxleyi: EMIHUDRAFT_439583
Entry
EMIHUDRAFT_439583 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ehx  Emiliania huxleyi
Pathway
ehx00100  Steroid biosynthesis
ehx01100  Metabolic pathways
ehx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    EMIHUDRAFT_439583
Enzymes [BR:ehx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     EMIHUDRAFT_439583
SSDB
Motif
Pfam: ERG4_ERG24
Other DBs
NCBI-GeneID: 17286003
NCBI-ProteinID: XP_005793161
JGI: Emihu1_439583
UniProt: R1E012
Position
Unknown
AA seq 460 aa
MLRPTRASPRLAGLKPARSQSPSRAGGSTPATSSTKPARKAGGKPQPEYEFGGPAGAAGV
MLLLPLVIGFLYAGCGKHGCIRLPEDALDVLAAAPLAPLWDWTAAAVVAGWTALHFLLYV
ALPGPRVEGVVLADGSRLKYPMNGHLAFWLSLAGFWHGLPLLGCKQSWVYDAYLPLATAA
CALSVALSVWSHALSYLPNTPLAEGGQTGNPVYDFFIGRPLNPRIGSLDLKACCELRPGL
VGWAVLNLGLAAKQHEQQGEVSWSMVAVVGGQLLYVWDALYNEQAILTTMDITTDGFGFM
LAFGDLAWVPFTYSLQARILVDHDPRLPAPAVAAIAALGALGYVVFRGANSQKDAFRRDP
SDPAVSHLQWMQTKRGTKLLVSGWWGAARKINYTGDWLMGLSWSLACGAASPVAYFYPVY
FAVLLVHRALRDDHFCATKYGADWEAYKRRVPFVFVPGIL
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgctccgccccacccgcgcctctcctcggctcgccgggctcaagccggcccggtcgcag
tcgccgtcgcgtgccggcggctccacgcccgccacctcgtcgacgaagcccgcacgcaag
gctggcggcaagccccagccagagtacgagtttggcggcccagccggcgcggcgggcgtg
atgctgctcctgccgctggtcatcggcttcctgtacgcggggtgcggcaagcacgggtgc
atacgcctgcccgaggacgcgctcgacgtgctcgccgccgcaccgctcgctccgctgtgg
gactggacggctgcggcggtggtggctgggtggacggcgctgcacttcctgctgtacgtc
gcgctgccggggccgcgggtggagggcgtcgtgctcgcggacggctcgcgcctcaagtac
ccgatgaacggccacctcgccttttggctctcgctcgccggcttttggcacgggctgccg
ctgctcggctgcaagcagtcgtgggtgtacgacgcgtacctcccgctcgcgacggcggcg
tgcgcgctgtcggtcgccctctccgtctggtcgcacgccctctcctacctcccgaacaca
cccctcgccgagggaggccagacgggcaacccggtgtacgacttcttcatcgggcggccg
ctcaacccgcggatcgggtcgctcgacctcaaggcgtgctgcgagctgcggccggggctg
gtcgggtgggcggtcctcaacttggggctggcggcgaagcagcacgagcagcagggcgag
gtgtcttggtcgatggtcgccgtggttggggggcagctcctgtacgtgtgggacgcgctc
tacaacgagcaggcgatcctcaccaccatggacatcaccactgacggcttcggcttcatg
cttgcctttggcgacctcgcttgggtccccttcacctactcgctccaggcgcgcatcctg
gtggaccacgaccctcgcctccccgcgccggccgtcgccgccatcgccgccctcggcgcg
ctcggctacgtcgtcttccgcggcgccaactcgcagaaggacgccttccgacgcgacccg
tccgaccctgccgtctcgcacctgcagtggatgcagaccaagcgcggcaccaagctgctc
gtctcgggctggtggggcgcagcgcgaaagatcaattacaccggcgactggctgatgggc
ctctcgtggtcgctcgcctgcggcgccgcctcgccggtggcctacttctacccagtctac
tttgcggtcctgctcgtccaccgcgcgctgcgagacgaccacttctgcgccaccaagtac
ggcgccgattgggaggcgtacaagcggcgcgtcccgttcgtctttgtgccaggcatcctc
tga

DBGET integrated database retrieval system