KEGG   Emiliania huxleyi: EMIHUDRAFT_44328
Entry
EMIHUDRAFT_44328  CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EMIHUDRAFT_44328
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     EMIHUDRAFT_44328
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 17276634
NCBI-ProteinID: XP_005783790
JGI: Emihu1_44328
UniProt: R1F7M6
Position
Unknown
AA seq 289 aa
RVVVSGGTHGNEYTGVWVLQRLQLRSAELAEQHPSIAIETLFANPPAHAANRRFIDDDLN
RQFSAATLADTTASSFEAGRAKAIAADMGPKGAAADAAVCIDMHTTTANMGCTVIVSSYS
TLALRAAAFVHTHWDDADEASPPLPLRVMVEECSQCEAAHLASVARHGIEIEVGPTPQSL
LRADVVASTERCLRLLLRYLELHYSGAEPATPATLPVYVSLGKVPFVDGADADGALPGAV
VAASLQDRDFAPLRAGEALFEALDGSLVPYDGSLGEVVHPVFINEAAYY
NT seq 867 nt   +upstreamnt  +downstreamnt
cgcgtggttgtctcgggtggcactcacggaaacgagtacaccggcgtatgggtcctccaa
cgcctgcagttgcgctcggcggagctcgcagagcagcacccttctatcgccatcgaaaca
ctcttcgcaaacccaccggctcacgctgccaatcgccgctttatcgacgacgatctcaat
cgccagtttagcgcggcgacccttgccgacacgacggcatccagctttgaggccgggcgc
gccaaggcaatcgcagcagacatggggccaaagggcgccgccgccgacgcggctgtgtgc
atcgacatgcacaccaccaccgccaacatgggctgcaccgttattgtgagctcgtacagc
accctcgcgcttcgagccgctgcgtttgtgcacacgcactgggacgacgccgacgaggca
tcgccgccgctgccgctgcgcgtgatggttgaggagtgcagccagtgcgaggcggcgcac
ctcgccagcgtcgcgcggcacggcatcgagatcgaggtcgggccgacgccgcagagcttg
ctgcgtgcggacgtggtcgcgtccacagagcgctgcctccggctgctgctgcggtacctc
gagctgcactacagcggcgcggagcctgccacgcccgccacgctgcccgtctacgtctcg
ctgggcaaggtgccctttgtggacggcgccgacgccgacggcgcgctccccggggcggtg
gtcgccgcttcgctgcaggaccgcgacttcgctccgctgcgggccggcgaggcgctcttc
gaggcgctggacggctctctcgtgccttacgacggctcgctcggcgaggtcgtccacccc
gtcttcatcaacgaggcggcctactac

DBGET integrated database retrieval system