KEGG   Emiliania huxleyi: EMIHUDRAFT_447922Help
Entry
EMIHUDRAFT_447922 CDS       T02915                                 

Definition
(RefSeq) hypothetical protein
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
ehx  Emiliania huxleyi
Brite
KEGG Orthology (KO) [BR:ehx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ehx01002]
    EMIHUDRAFT_447922
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ehx03110]
    EMIHUDRAFT_447922
Enzymes [BR:ehx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     EMIHUDRAFT_447922
Peptidases and inhibitors [BR:ehx01002]
 Serine peptidases
  Family S8: subtilisin family
   EMIHUDRAFT_447922
Chaperones and folding catalysts [BR:ehx03110]
 Intramolecular chaperones
  Subtilisin family
   EMIHUDRAFT_447922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII
Motif
Other DBs
NCBI-GeneID: 19046046
NCBI-ProteinID: XP_005770474
JGI: Emihu1_447922
UniProt: R1DU91
Position
Unknown
AA seq 998 aa AA seqDB search
METGTALVRALGAAIERGVHIINLSFGEYAKVDDIGRFTAAANLAVHKHGLLFVTSAGNN
GPALSTGGAPGTSSCCIAVGAYCSSAMMGPQYSLRAKLADIQYTWSSRGPTYDGHLNVSV
SAPGGAIAPVPNWTLQGRQLMNGTSMASPNACGGITLLLSALAARGERWSPASIRRAIET
TALRTPNATGSAVEVWALGRGLLQVGAALSWLEEHGGHAHCDVRFELSATTHGCSTAAGA
GARGVYLREPQHSSASEVGVDVFVRPRLHEEAPNAQRVSLDVGVTLQPSAPWLSCAPFLA
LTHGGKGFNLKVSPGQLPPGAHYAEVAGHDSSSPRRGPLFSLPVTVCKPHANLAAPHAPC
HVAFERVAFSPGHIERRFVVPPRGATWATLTLRARGAPRSREPAGSVVYMYSLTQLLPQK
HIGQSSETRRVTMGVPDEAQGAGAPATEYVSTVACVGGVTLEVAVAQWWMSLGETELDVE
QLTLDGRTLFSSLELHSFRRTSVEPEGSLKTLRRACRPLQAKLVPPAAPCGDVGIGDAGV
GGKTPIYDYLLSYKFALKEACEGVTVRFPSLSAQLYESGYEAQLWALFDAHKRLLRWGDY
YVRLQLRHDSPAHLEKLKDMPMVVDLQIAPVALSFHWSRASALDDPAAGPKPPLRRLLEP
HTRVALHVASPAAPAIAEPGDTLLGSATFAKLSSEGVGAGKRPGGWPVTLFVPPAAKKEE
PPKPASMDKEDETAPHRMEAALRALKISQLVKLSPKCKPPKEPAAAGEAAPLPHEAGGGE
ADEELAARGTDPHACGGAHLEHAEAMSEGRRAGEELLRGVLSLLDATQIAAALGVPHVDP
DDKRAKQRREVDEAQKKALVGALHLKAAALADLHKVAAAAGAGDGAGDGAGDGAGDGADS
KAALEALDAAVAALHRWAAKEEHWKLLVAWHRAHGYAATALAALDEHLAKEKGPPPKEKL
ELRLELLRELGWQHWVDNAKALLLLKYPQSYPPPFNSV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggagacgggcaccgcgctcgtccgcgcgctcggcgccgccatcgaacgaggcgtgcac
atcatcaacctctcgttcggcgagtacgcaaaggtggacgacatcggacgcttcacggcg
gccgccaacctcgccgtccacaagcacggcctcctcttcgtgacttcggcgggcaacaac
gggcctgccctctcgacgggcggtgcgcccggcacctcctcctgctgcatcgccgtcggc
gcctactgctcctcggcgatgatggggcctcagtactcgctccgcgccaagctcgccgac
atccagtacacttggtcctcccgcggaccaacctatgacggccacctcaacgtgagcgtc
tctgcgcccggcggggccatcgcacccgtccccaactggacgctgcagggccgccagctc
atgaacgggacgtcgatggcgtcgccaaacgcgtgcggcggcatcacgctcctgctgtct
gcgctcgcggcgcgcggcgagcgctggtcgcccgcgtcgatccggcgcgccatcgagacg
acggcacttcgcacgccaaacgccacgggcagcgcggtcgaggtctgggcgctcgggcgc
gggctgctgcaggttggcgcggcgctgagctggctcgaggagcacggcgggcacgcccac
tgtgacgtgcgctttgagctcagcgccacgacgcacggctgctcgaccgccgcgggcgcg
ggtgcgcgcggcgtctacttacgcgagccgcagcactcgagcgcgtcggaggttggtgtc
gacgtcttcgtgcgcccgaggctgcacgaggaggcgcccaacgcacagcgcgtctccctc
gacgtcggcgtcacgctgcagccaagcgcgccgtggttgagttgcgcgccgttcctcgcg
ctcacgcacggcggcaagggcttcaacctcaaagtgtcgcccggccagcttccgcctggc
gcgcactacgccgaggtggcgggccacgactcgtcttcgccgcggcgcggcccgctcttc
tcgctccccgtcaccgtctgcaagccgcacgcgaacctcgccgcgccgcacgcgccgtgc
cacgtcgccttcgagcgcgtcgccttctcccccggccacatcgagcgccgcttcgtcgtc
ccgccgcggggcgcgacttgggcgacgctgacgttgcgcgctcggggggcgccgcgctcg
cgcgagccggcgggcagcgtggtctacatgtactcgctcacgcagctgctgccacagaag
cacatcggccagtcgtctgagacccggcgcgtcaccatgggcgtgcctgacgaggcgcag
ggggctggcgcgccggcgacggagtacgtctcgaccgtcgcgtgcgtcggcggcgtgacg
ctggaggttgcggtggcgcagtggtggatgtcgctcggcgagacggagctcgacgtggag
cagctcacgctcgacgggcggaccctcttcagctcgctcgagctacactccttccgccgg
acgtcggtcgagccggagggttcgctcaagacgctgcgccgcgcgtgccgcccgctccag
gcgaagctcgtcccgcccgccgctccgtgcggcgacgtcggcatcggcgacgcgggcgtc
ggcggcaagacgccgatctacgactacctcctctcgtacaagttcgcgctcaaggaggcg
tgcgaaggcgtgacggtccgcttcccgtcgctctcggcgcagctgtacgagagcgggtac
gaggcgcagctgtgggctctcttcgacgcgcacaagcggctgctgcgctggggcgactac
tacgtgcggctccagctgcggcacgactcgcccgcgcatctcgagaagctcaaggacatg
ccgatggtggttgacctgcagatcgcgcccgtcgccctctccttccactggagccgcgcc
tccgccctcgacgaccccgccgccggcccgaagccgcctctgcgccgcctcctcgagccg
cacacacgcgttgcgctgcacgtggcgtcgccggccgcgcccgccatcgccgagccggga
gacacgctcctcggctcggccaccttcgccaagctgtcctccgagggggtcggcgctggc
aagcggcccggcggctggccagtgacgctgttcgtcccgccggccgccaagaaggaggag
ccgcccaagccggcgtccatggacaaggaggacgagacggcgccgcatcggatggaggcg
gcgctgcgcgcgctcaagatctcgcagctggtcaagctgtcgccaaagtgcaagccgcca
aaggagccggccgccgctggcgaggctgcgccgctgccgcacgaggcgggcggcggcgag
gcggacgaggaattggcggcaaggggcaccgatcctcacgcgtgtggcggggcgcacctc
gagcacgcagaggccatgtcggaggggcggcgggccggcgaggagctgctgcgcggagtg
ctctcgctgctcgacgcgacgcagatcgcggcggcgctcggcgtgccccacgtcgacccg
gacgacaagcgcgccaagcagcggcgcgaggtggacgaggcgcagaagaaggcgctcgtc
ggcgcgctccacctcaaggccgccgccctcgccgacttgcacaaggtggcggcggcggcc
ggcgcgggcgacggcgcgggcgacggcgcgggcgacggcgcgggcgacggcgcggacagc
aaggcggcactcgaggcgctcgacgccgccgtcgcggcgctgcatcgctgggcggccaag
gaggagcactggaagctgctcgtcgcgtggcaccgcgcgcacggctacgcagcgacggcg
ctggccgccctcgacgagcacctcgccaaggagaaggggccgccgccaaaggagaagctc
gagctgaggctcgagctgctacgcgagctcggctggcagcactgggtggacaatgcgaag
gcgctgctcctgctcaagtacccgcagagctacccgccgcctttcaactccgtgtga

DBGET integrated database retrieval system